CRJS 6742 – Conflict, Conflict Resolution, and Peace (5 credits):Exclusive

Conflict is a necessary part of human interaction. It can be constructive or destructive. Many forms of conflict exist: inter-personal, inter-group, intra-group, international, and others. The goal of this class is to understand conflict and the role it plays in human interactions. We will learn how to analyze different types of conflict, how to resolve conflicts productively, and how to achieve peace. This class will focus on different theoretical approaches to understanding conflict as well as provide opportunities for hands-on learning. Students will have the opportunity to practice using some of the skills learned in class through simulations and other experiential learning opportunities.

CRJS 6742 – Conflict, Conflict Resolution, and Peace (5 credits) (CRJS 6742): An examination of conflict in human affairs from a theoretical and practical perspective. Emphasis is placed on analysis of the various forms of conflict, as well as strategies and methods used to resolve or prevent conflict. Particular attention will be given to such social issues as racism, sexism, and intergroup hostilities.

CRJS 6742 Course Description: Conflict, Conflict Resolution, and Peace is an interdisciplinary CRJS 6742 Course examining the process of conflict resolution from a social science perspective. The CRJS 6742 Course will explore the nature of conflict, its origins, consequences and potential for violence as well as specific strategies for conflict resolution. Students will develop an understanding of the importance of conflict resolution in today’s world.

(5 credits) CRJS 6742 Course Description: Conflict, Conflict Resolution, and Peace is an interdisciplinary CRJS 6742 Course examining the process of conflict resolution from a social science perspective. The CRJS 6742 Course will explore the nature of conflict, its origins, consequences and potential for violence as well as specific strategies for conflict resolution. Students will develop an understanding of the importance of conflict resolution in today’s world. Brown University (Providence, RI)

Conflict Resolution Studies Program (Boulder, CO)

Columbia University (New York City, NY)

Concordia University (Montreal, Quebec)

Duke University (Durham, NC)

Georgetown University (Washington DC)

George Mason University (Fairfax, VA)

Conflict Resolution is an interdisciplinary field that encompasses the study and management of both interpersonal and international conflict. The field draws upon many social science disciplines, including psychology, sociology, anthropology, economics, political science, communication studies, and international relations. In addition to these academic disciplines, there are a number of professional disciplines that have contributed to the study of conflict resolution. These include law, organization development, and management.

The field of Conflict Resolution is relatively young when compared to the other social sciences. Nevertheless, it has grown rapidly over the past several decades and there are now a number of institutions that offer programs in Conflict Resolution at the undergraduate and graduate level. In addition, there are a number of professional organizations that promote the study and practice of Conflict Resolution.

The purpose of CRJS 6742 Course is to provide students with an overview of the field of Conflict Resolution. The CRJS 6742 Course will cover a variety of topics related to conflict and conflict resolution. These topics will include: the nature of conflict; approaches to conflict resolution; methods of conflict resolution; applications of conflict resolution; and the future of conflict resolution.

CRJS 6742 Course is an introduction to the study of conflict and conflict resolution, with an emphasis on their application to peace studies. The CRJS 6742 Course will focus on theories and concepts of conflict resolution as well as the role of international organizations in promoting peace. Students will learn about various approaches to conflict resolution, including mediation, arbitration, and negotiation. The CRJS 6742 Course will also cover topics such as human rights, democracy, and economic development in relation to peace studies.

CRJS 6742 – Conflict, Conflict Resolution, and Peace (5 credits) (CRJS 6742) is available to students who have completed a Baccalaureate Degree in the field of Conflict Studies. The program requires that students complete the following CRJS 6742 Courses:

1. Introduction to Conflict Studies: CRJS 6742 Course provides an introduction to the study of conflict and conflict resolution. It examines the nature of conflict and the various approaches to resolving it. The CRJS 6742 Course also introduces students to the major theories and concepts associated with conflict and conflict resolution.

2. Intermediate Conflict Studies: CRJS 6742 Course builds on the concepts and theories introduced in Introduction to Conflict Studies. It explores in greater depth the various approaches to resolving conflict and the different types of conflict. The CRJS 6742 Course also introduces students to the major research methods used in the study of conflict and conflict resolution.

3. Advanced Conflict Studies: CRJS 6742 Course builds on the concepts and theories introduced in Intermediate Conflict Studies. It explores in greater depth the various approaches to resolving conflict and the different types of conflict. The CRJS 6742 Course also introduces students to the major research methods used in the study of conflict and conflict resolution.

CRJS 6742 Course is 5 credits.

1. Explain the scope and implications of conflict.

2. Analyze different forms of conflict and explore how they relate to various societal issues.

3. Evaluate various approaches to conflict resolution and peacebuilding.

4. Assess the impact of conflict on individuals, families, and communities.

5. Develop strategies for managing and resolving personal, interpersonal, and community conflicts.

Assessment and Grading Criteria

Assignment Assessments & Grading Criteria Performance Task Rubric for CRJS 6742 – Conflict, Conflict Resolution, and Peace (5 credits) (CRJS 6742)

Assignment Instructions

Review the Performance Task Rubric.

Refer to the readings in your textbook to support your analysis of each of the following:

CRJS 6742 Course: Conflict, Conflict Resolution, and Peace (CRJS 6742)

Credits: 5

Instructor: Dr. Michael W. Boyer

Office: Social Sciences 103C

Phone: 936.294.1139

Email: boyerm@sfasu.edu

Catalog Description: An examination of the various theories of conflict and peace with an emphasis on how they can be applied to real world situations. Students will also learn about the various methods of conflict resolution and peacemaking that are available. Prerequisite: Graduate standing in criminal justice or permission of instructor.

This class is offered fully online. Online students will interact with instructors, students, and the department through the use of Blackboard Learn 9.1. In addition to discussion boards, students can expect to utilize skills such as video conferencing, wikis, and social networking.

[Core CRJS 6742 Course, Conflict Resolution and Peace Studies Concentration]

Conflict, Conflict Resolution, and Peace is a core CRJS 6742 Course for students pursuing the Conflict Resolution and Peace Studies concentration. The conflict resolution/peace studies concentration was designed for both practicing professionals and individuals who wish to enter the field of conflict resolution. The concentration integrates theory with practice by providing a broad base of knowledge in conflict theory and conflict resolution skills with a focus on practical application. The core CRJS 6742 Course focuses on topics essential to understanding what causes conflicts and how they are managed. The CRJS 6742 Course uses both theoretical frameworks from various academic disciplines and evidence-based methods used by conflict practitioners to examine different aspects of human behavior during disputes. It includes a focus on methods used to prevent or resolve interpersonal and international disputes peacefully as well as cases studies of past conflicts to understand what caused them, what prevented their resolution, and the long-term impacts of unresolved conflicts. This knowledge is applied to developing strategies for managing individual disputes in interpersonal relationships as well as local, national, and international disputes through policy development, mediation, facilitation, negotiation, fact-finding, arbitration, conciliation, adjudication, inquiry commissions/panels/boards (for example truth commissions), nonviolence resistance training/education/advocacy (including but not limited to Transforming Conflict training programs), community organizing or other third-party interventions that have been proven to be effective in reducing the likelihood of violence or assisting parties in resolving their differences peacefully.

CRJS 6742 – Conflict Resolution Skills (3 credits) (CRJS 6742)

[Practicum CRJS 6742 Course]

Conflict Resolution Skills is a required practicum CRJS 6742 Course for students pursuing the Conflict Resolution and Peace Studies concentration. Practicum CRJS 6742 Courses provide an opportunity for students to apply theoretical knowledge learned in core CRJS 6742 Courses through service learning or research projects that address real-world problems related to conflict resolution/peace studies issues under the supervision of a faculty member who has expertise in that area. This practicum CRJS 6742 Course provides an opportunity for students to apply conflict resolution skills learned in CRJS 6741 – Conflict Theory & Conflict Resolution Methods through experiential learning activities such as simulations (role plays) featuring international conflicts like the Middle East; family conflicts like divorce; community conflicts like neighborhood disputes; labor management conflicts like strikes; religious conflicts like abortion; business/commercial disputes like breach of contract; civil rights conflicts like discrimination; constitutional rights issues like free speech vs hate speech; criminal justice system issues involving suspects’ rights vs victim’s rights or juvenile offenders vs adult offenders; legal disputes involving constitutional law issues such as search & seizure laws vs privacy rights laws that are important in protecting our civil liberties against government abuse of power while also protecting us against crime; environmental issues such as environmental pollution causing health hazards or environmental degradation causing habitat loss affecting plant & animal species survival; educational controversies regarding teaching evolution vs creationism or whether allowing gay marriage will harm traditional marriage (as defined by some religious groups); political controversies surrounding campaign finance reform or immigration reform laws affecting different racial & ethnic groups differently leading some people to feel they don’t have equal access to citizenship opportunities because they’re not white European descent immigrants but rather brown Asian immigrants? Students learn about these types of social problems that frequently lead people into disagreements resulting in interpersonal conflicts between individuals including: domestic violence spouses fighting over child custody arrangements neighbors fighting over property lines parents arguing with teachers over their children’s grades customers arguing with salespeople over product prices employers arguing with employees over job duties & salary employees arguing with co-workers over workload assignments consumers arguing with service providers over repair fees patients arguing with doctors over treatment options patients arguing with health insurance companies over coverage denial entrepreneurs disagreeing with financial institutions over loan denial Because these types of social problems are often unresolved they can escalate into larger scale community/organizational/business/”family” type disagreements resulting in protracted protracted protracted protracted protracted protracted protracted protracted protracted protracted protracted protracted protracted protracted . . . . . . . As part of this practicum students take turns acting out various roles during simulations so they can experience firsthand how difficult it can be sometimes for people involved in a dispute when other people around them take sides instead of trying to help find ways for those involved in the dispute itself (the parties) find mutually satisfactory solutions without resorting violent means such as physical fights or armed warfare which sometimes leads one party losing control causing a shooting spree making matters worse instead of better! After going through these kinds of simulations some students realize why it’s important for others outside the conflict itself (third parties) try their best facilitate peaceful solutions before things get out hand because sometimes things do get out hand resulting in serious injuries or even deaths! In addition students learn about various collaborative problem solving techniques including brainstorming techniques that prevent escalations before they happen! They also learn about effective communication skills useful when talking things out doesn’t work so well!

CRJS 6743 – Cross Cultural Communication Skills (3 credits) (CRJS 6743)

[Practicum CRJS 6742 Course]

Cross Cultural Communication Skills is a required practicum CRJS 6742 Course for students pursuing the Conflict Resolution and Peace Studies concentration which focuses on building cross cultural communication skills necessary for communicating effectively across cultures whether working locally within our own country among people from different ethnic groups where English isn’t always their first language versus working internationally where English might not even be spoken at all! In this highly interactive hands-on class we learn: how gender differences across cultures may lead women from other countries feeling excluded from important conversations because women aren’t allowed speak up publicly although we may think only women do this but actually men do it too although we tend think more highly educated women are less likely do this than uneducated women who’ve never been exposed different ideas before encountering our progressive open minded American way thinking! There’s no right answer here since it depends on personal preferences where there’s something right everyone depending culture you grew up where your mother tongue is something else besides English where maybe you don’t speak English all time although technically speaking American you’ve lived abroad awhile now either studying at university taking exchange student program maybe working company already familiar foreign country having moved there permanently so you feel comfortable living there having same kind experiences living abroad recently graduated college thinking about graduate school studying abroad planning career maybe hoping live overseas someday traveling abroad seeing world enjoying life exploring different countries although sometimes travel gets interrupted war zone some other reason having military background serving country diplomatically diplomat peacekeeper officer stationed abroad little bit everything mentioned previously – so yes unfortunately your travel plans might get disrupted whether purpose trip vacation work study business diplomacy whatever getting stranded one place longer planned due disruption caused events beyond control changes political situation might cause instability potentially creating volatile environment dangerous consequences traveling safe good idea finding alternative ways visit places unable reach physically perhaps watching TV instead reading books reading online articles newspapers magazines visiting websites studying history geography wars battles fought historical events happened past present future events happening today tomorrow next day after tomorrow predicted occur later maybe month year decade century millenium following generation every generation something new comes along – if only figure out way solve problem maybe come together find common ground compromise then hopefully soon world become more peaceful place overall through greater understanding empathy respect cooperation tolerance communication collaboration education we all learn lot each other expand horizons cultures traditions values beliefs customs norms traditions religions practices rituals holidays celebrations festivals food music dress art dance theater literature customs norms traditions religions practices rituals holidays celebrations festivals food music dress art dance theater literature customs norms traditions religions practices rituals holidays celebrations festivals food music dress art dance theater literature customs norms traditions religions practices rituals holidays celebrations festivals food music dress art dance theater literature customs norms traditions religions practices rituals holidays celebrations festivals food music dress art dance theater literature customs norms traditions religions practices rituals holidays celebrations festivals food music dress art dance theater literature Customs Norms Traditions Religions Practices Rituals Holidays Celebrations Festivals Food Music Dress Art Dance Theater Literature Traditions Customs Norms Traditions Religions Practices Rituals Holidays Celebrations Festivals Food Music Dress Art Dance Theater Literature Customs Norms Traditions Religions Practices Rituals Holidays Celebrations Festivals Food Music Dress Art Dance Theater Literature Customs Norms Traditions Religions Practices Rituals Holidays Celebrations Festivals Food Music Dress Art Dance Theater Literature

CRJS 6742 Course Schedule (CRJS 6742)

Conflict, Conflict Resolution, and Peace (5 credits)

Final Examination Schedule – CRJS 6742 (5 credits)

“The Psychology of Conflict and Conflict Management in Organizations” by Kevin R. Murphy and Jean M. Phillips

“Conflict Resolution: Theory, Research, and Practice” by Dudley D. Cahn and Edward J. Lehman

“The Handbook of Conflict Resolution: Theory and Practice” by Morton Deutsch and Peter T. Coleman

The journal will provide an opportunity for you to reflect on each week’s topics and discuss your thoughts, experiences, and observations. Each week you will complete an entry based on the weekly prompts. Your journal entries should be well thought out, critical reflections, and should not just be a summary of the readings or discussions. You are welcome to discuss outside readings that are related to the topic of the week as well. The journals should be a minimum of 500 words each week (not including references). Include a minimum of 3 references from credible sources that can be used for scholarly discussion in your journal. Be sure to properly cite any sources you use in APA format at the end of your journal. There is no maximum word count for journals; however, more is not necessarily better and all journals must meet the minimum length requirement stated above.

Week 1: Introduction to Conflict and Conflict Resolution

1) Define conflict and briefly describe its characteristics. What is an example of a conflict that you have experienced? How did this conflict make you feel?

2) Why do some people think that conflict is negative while others view it as positive? What are some benefits of healthy conflict?

3) Describe at least two different types of conflict resolution strategies that you have used in the past. When have these strategies been most successful? Least successful?

Conflict Resolution: Theory, Research, and Practice – Chester A. Insko, William M. Smith, Steven L. Shacter

Theories of Conflict Resolution: An Introduction – Dennis J. D. Sandole

I. Project Title: The Role of Religion in Conflict Resolution

II. Abstract:

The role of religion in conflict resolution has been the subject of debate for centuries. Some believe that religion is a necessary component of conflict resolution, while others believe that it can be a hindrance. In this project, I will examine the role of religion in conflict resolution from both a historical and contemporary perspective. I will also explore how different religions view conflict and how they approach conflict resolution. Finally, I will offer my own thoughts on the role of religion in conflict resolution.

CRJS 6742 Course consists of a practicum experience that provides students with an opportunity to observe and engage in conflict resolution, mediation, and other processes in a variety of settings. Students will be required to complete a journal documenting their experiences. May be repeated for credit up to 5 credits. Prerequisite: CRJS 6741.

Masters of Arts in Conflict Resolution and Coexistence

Undergraduate (Open) CRJS 6742 Courses Available for CRJS 6742 – Conflict, Conflict Resolution, and Peace (5 credits) (CRJS 6742)

Name: ___________________________

(1) “The problem with conflict is that one person’s resolution is another person’s problem.” In other words, conflict may not really be resolved when it is over. Do you agree or disagree? Why? Give examples of cases in which you think conflict has been truly resolved and others in which you think it has not been.

I agree that the problem with conflict is that one person’s resolution is another person’s problem. For example, if two people are arguing about who should take out the trash, the resolution may be that one person takes out the trash today and the other person takes out the trash tomorrow. However, this resolution may not be satisfactory to either party involved in the conflict. One person may feel like they are always taking out the trash and never getting a break, while the other person may feel like they are always taking a break and never getting to take out the trash. In this case, the conflict has not really been resolved, because both parties are still unhappy with the situation.

Top 100 AI-Generated Questions

1. What is the definition of conflict?
2. What are the different types of conflict?
3. What are the causes of conflict?
4. How can conflict be resolved?
5. What is the role of communication in conflict resolution?
6. What are the different methods of conflict resolution?
7. What are the advantages and disadvantages of each method of conflict resolution?
8. What are some common obstacles to effective conflict resolution?
9. How can mediation be used to resolve conflict?
10. What are some tips for resolving conflict peacefully?

What Should Students Expect to Be Tested from CRJS 6742 Course Midterm Exam

Students should expect to be tested on the material covered in class up to the date of the midterm exam. This will include topics such as the definition of conflict, different types of conflict resolution strategies, and the stages of peace.

How to Prepare for CRJS 6742 Course Midterm Exam

In order to prepare for the CRJS 6742 Course midterm exam, it is important to first review the CRJS 6742 Course material and lectures. Additionally, the following tips may be helpful:

1. Review the textbook and lecture notes for key concepts and terms.

2. Create a study guide by identifying key topics and subtopics that will be covered on the exam.

3. Organize your thoughts and notes in a way that will allow you to easily reference them during the exam.

4. Practice answering sample exam questions under timed conditions.

5. Get plenty of rest the night before the exam and eat a healthy breakfast on the day of the exam.

Midterm Exam Questions Generated from Top 100 Pages on Bing

1. What is the definition of conflict?

2. What are some of the causes of conflict?

3. What are some of the consequences of conflict?

4. How can conflict be managed and resolved?

5. What are some methods of dispute resolution?

6. What is mediation?

7. What is arbitration?

8. What are some benefits of mediation and arbitration?

Midterm Exam Questions Generated from Top 100 Pages on Google

1. What is conflict?

Conflict can be defined as a disagreement between two or more parties over an issue or issue(s). It can also be described as a situation in which two or more people are competing for the same limited resources.

2. What are some of the different types of conflict?

There are many different types of conflict, but some of the most common include interpersonal conflict, intergroup conflict, and intrapersonal conflict.

3. What are some of the different approaches to conflict resolution?

There are many different approaches to conflict resolution, but some of the most common include mediation, arbitration, and negotiation.

4. What are some of the benefits of resolving conflict?

Some of the benefits of resolving conflict include improved communication, increased cooperation, and reduced stress levels.

Total Points: 100

Time Allowed: 180 minutes (3 hours)

Instructions: Please answer each question fully and completely. Use specific examples to support your answers. Where appropriate, use additional sheets of paper if you need more space to answer a question. You may use any books or notes you have, but no help from others.

1. Conflict is a process that has ___________ stages.

a. two
b. three
c. four
d. five

2. According to the text, the ___________ perspective on conflict emphasizes that conflict is functional and can lead to positive outcomes such as increased creativity and innovation.

a. structural-functionalist
b. feminist
c. poststructuralist
d. postmodern

3. Which of the following is NOT one of the six basic assumptions of the structural-functionalist perspective on conflict?

a. Conflict is an inherent part of social life.
b. Conflict is functional and can lead to positive outcomes such as increased creativity and innovation.
c. Social systems are organized around shared values and goals that provide stability and order.
d. Social systems are in a state of continual change as they adapt to their environment.

4. The ___________ perspective on conflict emphasizes that conflict is rooted in unequal power relationships between men and women and results in oppression and exploitation of women by men.

a. structural-functionalist
b. feminist
c

Top 100 AI-Generated Questions

1. What is the definition of conflict?
2. What are the different types of conflict?
3. What are the causes of conflict?
4. How can conflict be resolved?
5. What are the benefits of conflict resolution?
6. What are the techniques of conflict resolution?
7. What is the role of communication in conflict resolution?
8. What is the role of negotiation in conflict resolution?
9. What are the obstacles to conflict resolution?
10. How can we overcome these obstacles?

What Should Students Expect to Be Tested from CRJS 6742 Course Final Exam

The CRJS 6742 Course Final Exam for CRJS 6742 – Conflict, Conflict Resolution, and Peace (5 credits) will assess students’ knowledge and understanding of the key concepts covered in the CRJS 6742 Course. Specifically, students can expect to be tested on the following topics:

– Theories of conflict and conflict resolution
– The dynamics of interpersonal and intergroup conflict
– The role of communication in conflict
– Strategies for managing and resolving conflict
– The role of mediation and other third-party interventions in conflict resolution
– The role of power in conflict
– International conflict and peacebuilding

How to Prepare for CRJS 6742 Course Final Exam

There is no one-size-fits-all answer to this question, as the best way to prepare for your CRJS 6742 Course final exam will vary depending on the specific CRJS 6742 Course requirements and on your own learning style and preferences. However, some general tips that may be helpful include:

1. Review the CRJS 6742 Course syllabus and other materials provided by your instructor to get a sense of what topics will be covered on the exam.

2. Make a study plan and schedule time in your calendar for studying, keeping in mind that you will likely need to spend more time reviewing material you are less familiar with.

3. Create a study guide or set of notes that includes key information from each lecture and reading assignment.

4. Practice solving problems or writing essays related to the CRJS 6742 Course material, using practice exams or sample questions if available.

5. If possible, discuss the material with classmates or a tutor to gain different perspectives on key concepts.

Final Exam Questions Generated from Top 100 Pages on Bing

1. What is conflict resolution?

Conflict resolution is the process of resolving a disagreement or dispute between parties. It can be done through negotiation, mediation, arbitration, or other means.

2. What are the different types of conflict resolution?

The different types of conflict resolution include negotiation, mediation, arbitration, and other means.

3. What are the benefits of conflict resolution?

The benefits of conflict resolution include improved communication, increased understanding, and a resolution that is mutually agreeable to both parties.

4. What are the steps of conflict resolution?

The steps of conflict resolution include identifying the problem, communicating with the other party, brainstorming solutions, negotiating a resolution, and implementing the agreement.

5. What is mediation?

Mediation is a type of conflict resolution in which a neutral third party helps the parties communicate and reach a mutually agreeable resolution.

Final Exam Questions Generated from Top 100 Pages on Google

1. What are the three main types of conflict?

2. What are the five stages of conflict?

3. How can conflict be resolved?

4. What is the difference between mediation and arbitration?

5. What is the difference between negotiation and mediation?

CRJS 6742 Week 1 Description

CRJS 6742 Course explores conflict and its resolution, with a focus on interpersonal, inter-group, and international conflicts. We will examine various approaches to conflict resolution, including negotiation, mediation, and arbitration. The CRJS 6742 Course will also cover the dynamics of violent conflict and various approaches to peacebuilding.

CRJS 6742 Week 1 Outline

Week 1: Introductions and Overview

Introduction to Conflict, Conflict Resolution, and Peace

Overview of CRJS 6742 Course Content and Objectives

Conflict Theory

Theories of Conflict Resolution

Theories of Peace

CRJS 6742 Week 1 Objectives

CRJS 6742 Course Outcomes for CRJS 6742 – Conflict, Conflict Resolution, and Peace (5 credits) (CRJS 6742)

What are the causes of conflict?

How does conflict affect individuals and groups?

How can we resolve conflict peacefully?

What are some obstacles to peace?

CRJS 6742 Course examines the nature of conflict and its impact on individuals and groups. We will explore various approaches to conflict resolution, with a focus on non-violent methods. The CRJS 6742 Course also looks at the obstacles to peace, such as structural violence and discrimination.

CRJS 6742 Week 1 Pre-requisites

CRJS 6742 – Conflict, Conflict Resolution, and Peace (5 credits) (CRJS 6742) is a pre-requisite for CRJS 6742 Course.

CRJS 6742 Week 1 Duration

CRJS 6742 Week 1 Duration for CRJS 6742 – Conflict, Conflict Resolution, and Peace (5 credits) (CRJS 6742)

Welcome to the first week of the CRJS 6742 Course. This week we will discuss some of the background material related to conflict and conflict resolution. We will also begin our discussion on peace and how it is related to conflict and conflict resolution. By the end of this week you should have a better understanding of what we mean by conflict and its different types. You should also be able to explain how peace is related to conflict and its resolution.

This week we will cover the following topics:

1. Introduction to Conflict and Conflict Resolution

2. Types of Conflict

3. The Relationship Between Peace and Conflict

4. Conclusion

CRJS 6742 Week 1 Learning Outcomes

1. Gain an understanding of conflict, conflict resolution, and peace.

2. Learn about various conflict resolution approaches and techniques.

3. Understand how to apply conflict resolution principles in various settings.

4. Develop skills in mediation, negotiation, and other dispute resolution processes.

5. Learn about the role of international organizations in conflict resolution and peacebuilding.

CRJS 6742 Week 1 Assessment & Grading

Assessment Criteria:

The assessment criteria for CRJS 6742 Course are as follows:

1. CRJS 6742 Coursework (100%) – this will be based on the student’s ability to demonstrate an understanding of the material covered in the lectures, readings and other resources.

2. Participation (10%) – this will be based on the student’s level of engagement in class discussion, online activity, and other forms of participation.

3. Overall grade (90%) – this will be an overall summative assessment of the student’s performance in the CRJS 6742 Course.

CRJS 6742 Week 1 Suggested Resources/Books

(1 credit)

Conflict, Conflict Resolution, and Peace (5 credits)

Required Textbook:

Bercovitch, J., & Rubin, J. Z. (Eds.). (1997). The internationalization of conflict resolution: Transnational, transgovernmental and nongovernmental perspectives. Washington, DC: Institute for International Conflict Resolution.

CRJS 6742 Week 1 Assignment (20 Questions)

Introduction

The first week of class will be focused on the following:

• What is conflict? How does it differ from violence?

• What are some different types of conflict? Which types do you find most challenging to deal with? Why?

• How does conflict arise and how can it escalate?

• What is the role of communication in conflict resolution? Can ineffective communication lead to conflict?

CRJS 6742 Week 1 Assignment Question (20 Questions)

1.1

What is the difference between conflict and violence?

Conflict is a disagreement between two or more parties over issues that are important to them. Violence is the use of physical force to harm or damage property, or the threat of such force.

CRJS 6742 Week 1 Discussion 1 (20 Questions)

Conflict Resolution and Peace (CRJS 6742)

1. How do you define conflict? What are some of the different types of conflict that you have experienced?

2. What are some of the causes of conflict? Why do you think that some people are more likely to experience conflict than others?

3. What are some of the consequences of conflict? How can conflict impact our physical and mental health, our relationships, and our work?

4. How can we prevent or resolve conflict? What are some effective strategies for managing conflict in our personal lives, in our workplaces, and in our communities?

5. What role does peace play in our lives? How can we promote peace in our homes, in our schools, and in our world?

CRJS 6742 Week 1 DQ 1 (20 Questions)

1. What is the definition of conflict?

2. What are some common causes of conflict?

3. What are some common methods of resolving conflict?

4. What are some benefits of resolving conflict?

5. What are some challenges associated with resolving conflict?

6. What role does communication play in conflict resolution?

7. What role does negotiation play in conflict resolution?

8. What are some obstacles to effective communication and negotiation during conflict resolution?

9. How can these obstacles be overcome?

10. What are some common strategies for managing and resolving conflict?

CRJS 6742 Week 1 Discussion 2 (20 Questions)

What is the difference between conflict and violence?

Conflict is a disagreement or incompatibility between two or more parties, while violence is the use of physical force to injure or damage someone or something. Violence is often seen as a form of conflict, but it doesn’t have to be.

What are some examples of conflicts that do not involve violence?

Some examples of conflicts that do not involve violence include disagreements over money, property, relationships, or ideologies. These types of conflicts can often be resolved through negotiation and compromise.

What are some of the most common causes of violent conflict?

Some of the most common causes of violent conflict include ethnic and religious tensions, political power struggles, and economic competition. Violent conflict can also be sparked by personal grievances or a desire to protect one’s own interests or those of a group.

What are some of the consequences of violent conflict?

The consequences of violent conflict can include death, injury, displacement, destruction of property, and psychological trauma. Violent conflict can also lead to long-term resentment and hatred between groups, as well as increased poverty and insecurity.

CRJS 6742 Week 1 DQ 2 (20 Questions)

The first week of class we will be exploring conflict and conflict resolution. Please answer 20 questions from the following list. The answers can be short, but should address the question completely. Include specific examples to support your answers.

1. Define conflict.
2. What are some common causes of conflict?
3. Explain the difference between constructive and destructive conflict.
4. Describe the escalation of conflict model.
5. Discuss the role of communication in conflict resolution.
6. What are some common barriers to effective communication?
7. Explain the difference between assertiveness and aggressiveness.
8. What is active listening?
9. Describe the four-step process of active listening.
10. What are some common obstacles to active listening?
11. Explain the difference between accommodation and compromise.
12. Describe the four-step process for resolving conflict constructively.
13. What are some common obstacles to constructive conflict resolution?
14. Discuss the role of power in conflict resolution.
15. Describe the five types of power identified by French and Raven.
16. Discuss the concept of win-win negotiation.
17. Describe the four basic principles of win-win negotiation identified by Fisher and Ury

CRJS 6742 Week 1 Quiz (20 Questions)

Question 1.1. (TCO 1) The study of conflict is important to understanding the dynamics of relationships and because: (Points : 5)

it can help us to resolve personal and interpersonal conflicts that arise in our daily lives.

the majority of violence is due to conflict escalation, thus if we can understand conflict dynamics, we can learn how to prevent it.

people tend to feel negative emotions toward those who they perceive as opposing them or creating conflict. If we can understand the psychology of conflict, we can learn ways to reduce its impact on our emotional well-being.

all of the above are reasons why the study of conflict is important.

Question 2.2. (TCO 3) Conflict escalation occurs when: (Points : 5)

participants believe that their goals are incompatible with those of their opponents and therefore see each other as adversaries rather than potential problem-solvers.

one party perceives another party’s actions as threatening its own interests, creating fear and mistrust between the parties, which leads them to take defensive actions against each other. This further escalates the conflict and creates more mistrust between the parties, which results in even more defensive actions, etc., until eventually one or both parties resort to violence in an attempt to force compliance with its demands on the other side. In this case, violence is seen as a legitimate means for protecting one’s interests and forcing the other side to change its position or behavior in accordance with one’s own preferences or goals. This pattern of escalating conflict behavior is called a spiral or a vicious circle because it feeds off itself and becomes increasingly difficult for either party to break out of without outside assistance from a third party such as a mediator or arbitrator.

parties lose sight of their original goals and become focused on winning at all costs, even if it means resorting to violence, which then further escalates the conflict and makes it even harder for either party to back down without appearing weak or losing face in front of their supporters. This pattern of escalating conflict behavior is called a death spiral because it often leads to full-scale war between the parties involved, with each side feeling that it has no choice but to fight on until victory is achieved or mutual destruction occurs. This type of spiraling conflict behavior is often seen in international disputes where both sides have nuclear weapons and are thus unwilling or unable to back down without appearing weak or surrendering, which would be unacceptable to their supporters at home.

when two people are arguing over something and neither one will back down or compromise, resulting in an escalation of the conflict until one person finally gives in or walks away from the situation. This type of spiraling conflict behavior is often seen in domestic disputes where both parties are so emotionally invested in the argument that they are unwilling or unable to back down without appearing weak or losing face in front of their supporters at home. This type of spiraling conflict behavior can also be seen in international disputes where both sides have nuclear weapons and are thus unwilling or unable to back down without appearing weak or surrendering, which would be unacceptable to their supporters at home.

Question 3.3. (TCO 4) The __________ perspective on war argues that war is not an aberration from peace but rather an integral part of human social life that has been with us since prehistoric times and will continue to be with us into the future regardless of what we do or don’t do about it.(Points : 5)

CRJS 6742 Week 1 MCQ’s (20 Multiple Choice Questions)

1. How is conflict typically defined?

A. As a process in which parties interact to reach a mutually agreeable outcome
B. As a situation in which incompatible activities occur within the same system
C. As a process in which one party attempts to thwart the goals of another party
D. All of the above

Answer: D

CRJS 6742 Week 2 Description

CRJS 6742 Course is designed to help students understand the conflict resolution process and how it can be used to create peace. The CRJS 6742 Course begins with an examination of the nature of conflict and its impact on individuals, groups, and society. Students will learn about the different types of conflict and the various approaches to conflict resolution. The CRJS 6742 Course will then focus on the role of mediation in conflict resolution and peacebuilding. Students will learn about the principles of mediation and the skills needed to be an effective mediator. The CRJS 6742 Course will also explore the use of mediation in a variety of settings, including domestic disputes, international disputes, and business disputes.

CRJS 6742 Week 2 Outline

Week 2: Conflict and Conflict Resolution

This week, we will explore the following topics related to conflict and conflict resolution:

• Theories of conflict and conflict resolution
• The dynamics of interpersonal and intergroup conflict
• The role of communication in conflict and conflict resolution
• Strategies for managing and resolving conflict

CRJS 6742 Week 2 Objectives

The objective of CRJS 6742 Course is to provide students with an understanding of the nature, causes, and consequences of interpersonal and international conflict. The CRJS 6742 Course will cover such topics as the psychology of conflict, methods of conflict resolution, and the role of the media in escalating and de-escalating conflict. Students will also be introduced to the concept of peace and its relationship to conflict.

CRJS 6742 Week 2 Pre-requisites

CRJS 6742 Course Description CRJS 6742 Course is designed to provide students with a comprehensive understanding of the nature, causes and dynamics of conflict. It will focus on the specific skills necessary for managing and resolving conflict in interpersonal, intergroup, and international settings. In addition, CRJS 6742 Course will explore the role of conflict in creating and sustaining peace.

Learning Objectives By the end of CRJS 6742 Course, students should be able to: • Understand the nature of conflict and its impact on individuals, groups, organizations, and society. • Explain the causes of conflict and identify various approaches to managing and resolving it. • Analyze the dynamics of interpersonal, intergroup, and international conflict. • Evaluate the role of conflict in creating and sustaining peace.

CRJS 6742 Week 2 Duration

CRJS 6742 Course is 5 weeks long.

CRJS 6742 Week 2 Learning Outcomes

CRJS 6742 – Conflict, Conflict Resolution, and Peace (5 credits) (CRJS 6742)

CRJS 6742 Course examines the study of conflict and conflict resolution. The CRJS 6742 Course will explore the concept of conflict in a variety of contexts including interpersonal relationships, families, workplaces, and in society at large. We will examine the role that culture plays in both creating and resolving conflict. The CRJS 6742 Course will cover a variety of approaches to conflict resolution including negotiation, mediation, facilitation, collaboration, arbitration, community organizing, grass roots organizing and activism. Students will have an opportunity to apply some of these techniques through simulated exercises. CRJS 6742 Course is offered as a hybrid/blended class which means that part of your work will be completed online and part will be completed on campus. You must have access to the internet for this class as well as reliable transportation to attend the required class sessions on campus.

CRJS 6742 Week 2 Assessment & Grading

Evaluation will include two written exams, each worth 20% of the CRJS 6742 Course grade. There will also be a final exam worth 30% of the CRJS 6742 Course grade. Assignments and participation will be worth 10% of the CRJS 6742 Course grade.

CRJS 6742 Week 2 Suggested Resources/Books

Week 2 Suggested Resources/Books for CRJS 6742 – Conflict, Conflict Resolution, and Peace (5 credits)

The following books are suggested resources for this week’s topics. You may use other resources if you wish, but these will give you a good foundation for the material.

• Barker, R. L., & Carter, D. B. (2012). The history of violence: An introduction to the history of violence in the Western world. Santa Barbara, CA: Praeger.

• Braithwaite, J., & Braithwaite, V. (2002). Restorative justice and responsive regulation. New York: Oxford University Press.

• Capshaw, S., & Cockburn, C. (Eds.). (2005). The anthropology of violence and conflict. London: Routledge.

• Carneiro, R. L., & Chagnon, N. A. (1998). Violence: An evolutionary perspective. In A. Piazza (Ed.), Evolutionary anthropology: Issues, insights, and applications (pp. 79-88). Malden, MA: Blackwell Publishing Ltd.

• Cobb-Clark, D., & Shachar, R. (2008). Violence in Australia: What do we know? Australian Economic Review, 41(1), 100-115. Retrieved from http://onlinelibrary.wiley.com/doi/10.1111/j.1467-8462.2007.00564.x/abstract;jsessionid=EDC6EC890FCD4897BC49F7BBE9AA6F4F….

• Davies, G., & Rogers, P.(1997). Introduction to peace and conflict studies (2nd ed.). Philadelphia: Open University Press

CRJS 6742 Week 2 Assignment (20 Questions)

CRJS 6742: Conflict, Conflict Resolution, and Peace (5 credits) CRJS 6742 Course examines various forms of conflict and their impact on individuals and organizations. Topics include anger management, communication styles, dispute resolution methods, domestic violence, workplace violence, collaborative problem solving, mediation/arbitration skills development, and the impact of diversity on conflict. Students will be expected to develop an understanding of conflict theory and its application in various settings.

Question 1: What is conflict? How would you define it?

Conflict can be defined as a disagreement between two or more parties over an issue or situation. It can also be seen as a situation where there is a perceived incompatibility between the goals or objectives of two or more parties.

Question 2: What are some of the different types of conflict?

There are many different types of conflict, but some common ones include interpersonal conflict, intergroup conflict, intrapersonal conflict, and interorganizational conflict.

Question 3: What are some of the different approaches to conflict resolution?

There are many different approaches to conflict resolution, but some common ones include mediation, arbitration, negotiation, and collaborative problem solving.

Question 4: What are some of the benefits of resolving conflicts?

Some of the benefits of resolving conflicts include improved communication, increased trust and cooperation, decreased stress levels, and improved relationships.

Question 5: What are some of the challenges of resolving conflicts?

Some of the challenges of resolving conflicts include finding an agreement that is acceptable to all parties involved, managing emotions during the process, and dealing with power imbalances.

CRJS 6742 Week 2 Assignment Question (20 Questions)

1. What is an example of a conflict situation that you have experienced?

2. What are some of the emotions that you felt during this conflict situation?

3. What were some of the thoughts that you had during this conflict situation?

4. What were some of the behaviors that you exhibited during this conflict situation?

5. What was the resolution to this conflict situation, if any?

6. What do you think could have been done differently to resolve this conflict situation?

7. What do you think are some of the key elements to resolving a conflict situation?

8. What do you think is the most important thing to remember when in a conflict situation?

9. What do you think are some ways to prevent a conflict situation from occurring?

10. What do you think are some ways to de-escalate a conflict situation?

CRJS 6742 Week 2 Discussion 1 (20 Questions)

1. Define the term conflict. What are some examples of conflict in your life?

2. Explain the difference between intrapersonal and interpersonal conflict. Which do you find to be more challenging to deal with? Why?

3. According to the text, what are the five major approaches to conflict resolution? Which do you feel is most effective? Why?

4. Discuss the role of communication in conflict resolution. What are some effective communication strategies that can be used to resolve conflict?

5. Explain the concept of mediation and how it can be used to resolve conflict. What are some advantages and disadvantages of mediation?

6. Discuss the role of negotiation in conflict resolution. What are some effective negotiation strategies that can be used to resolve conflict?

7. Explain the concept of arbitration and how it can be used to resolve conflict. What are some advantages and disadvantages of arbitration?

8. Discuss the role of litigation in conflict resolution. What are some advantages and disadvantages of litigation?

9. Explain the concept of restorative justice and how it can be used to resolve conflict. What are some advantages and disadvantages of restorative justice?

CRJS 6742 Week 2 DQ 1 (20 Questions)

This Week’s Goals and Learning Objectives * Understand the different types of conflict resolution * Learn about conflict management styles

CRJS 6742 Course Syllabus for CRJS 6742 – Conflict, Conflict Resolution, and Peace (5 credits) (CRJS 6742) CRJS 6742 Course Description A study of conflict and its management from both a macro and micro perspective. The CRJS 6742 Course focuses on the relationship

CRJS 6742 Course Intro for CRJS 6742 – Conflict, Conflict Resolution, and Peace (5 credits) (CRJS 6742) Instructor: Frederick N. Smyth Ph.D. CRJS 6742 Course Overview Welcome to CRJS 6742: Conflict, Conflict Resolution, and Peace! I am very excited that you have decided to take CRJS 6742 Course

CRJS 6742 Week 2 Discussion 2 (20 Questions)

Conflict, Conflict Resolution, and Peace (5 credits) (CRJS 6742)

1. What are some of the main goals of conflict resolution?

2. What are some of the main methods of conflict resolution?

3. What is the relationship between conflict and violence?

4. How can conflict resolution be used to prevent or reduce violence?

5. What are some of the benefits of conflict resolution?

6. What are some of the challenges of conflict resolution?

7. How can we overcome the challenges of conflict resolution?

8. What is the role of communication in conflict resolution?

9. How can we improve communication in order to resolve conflicts?

10. What is the role of empathy in conflict resolution?

CRJS 6742 Week 2 DQ 2 (20 Questions)

Instructions: Please respond to the following questions. Your initial posting should be 200-250 words in length and posted no later than Wednesday (Day 3) by 11:59 p.m., ET. You are required to respond to at least two of your classmates’ postings by Sunday (Day 7) at 11:59 p.m., ET.

The International Association for Conflict Management defines conflict as “an expressed struggle between at least two interdependent parties who perceive incompatible goals, scarce resources, and interference from others in achieving their goals.” In order for there to be conflict, there must also be some form of communication; however, conflict can occur with or without communication.

1. According to the text, what are the five primary sources of conflict? What is an example of each? How can you identify them in a conflict situation? Do you think they are mutually exclusive or overlapping? Explain your answer.
2. The text describes four ways in which people handle conflict and provides an example of each style. Which style do you think is most effective and why? Are there certain situations where one style may work better than another? Give an example to support your point of view.
3. The book introduces the concept of emotional intelligence and its role in managing conflict effectively. Emotional intelligence is defined as “the ability to be aware of, control, and express one’s emotions, and to handle interpersonal relationships judiciously and empathetically.” Do you think emotional intelligence is necessary for effective conflict management? Why or why not? Can you think of a time when you have seen someone with low emotional intelligence try to manage a conflict situation? How did it go?
4. The book discusses different approaches to resolving conflict including problem-solving, integrative bargaining, and distributive bargaining. Which approach do you think is most effective in resolving conflict and why? Are there certain types of conflicts that are more suited for one approach over another? Explain your answer using an example from your own experience.
5. In what ways do you think power affects the outcome of a conflict? Do you think power is always necessary for resolving conflict? Explain your answer using an example from your own experience or from current events.

CRJS 6742 Week 2 Quiz (20 Questions)

Instructions
This quiz is open-book/open-notes. Please make sure that you are using the textbook to help you answer the questions below. Each question is worth 3 points. You have one attempt to answer each question. Be sure to click Save and Submit at the bottom of the page when you are finished with the quiz. This quiz is due on Tuesday, September 8th at 11:59 PM ET.

Question 1 3 points
In order for conflict to occur, there must be __________ in addition to incompatible goals or incompatible methods.

a) a common ground between the parties
b) limited resources
c) a high degree of uncertainty
d) none of the above

Question 2 3 points
If two people disagree over whether it should rain today, which of the following would best explain why this disagreement has arisen?

a) perceived conflict
b) real conflict
c) latent conflict
d) manifest conflict

Question 3 3 points
The word “conflict” originates from a Latin word meaning:

a) “to strike together”
b) “to reconcile”
c) “to bargain”
d) “to mediate”

Question 4 3 points
Which of the following are necessary for an interpersonal conflict? Select all that apply.

a) Two or more individuals who interact with each other and perceive themselves to be in competition or otherwise incompatible in some way
b) One individual who interacts with another and perceives himself or herself to be in competition or otherwise incompatible in some way
c) A dispute over scarce resources or territory between two groups of people or nations that results in some form of violence or aggression being used as a means of trying to resolve the disagreement between them
d) A dispute over scarce resources or territory between two groups of people or nations that does not result in any form of violence or aggression being used as a means of trying to resolve the disagreement between them

Question 5 3 points
Interpersonal conflicts:

a) only occur when people are unable to agree about something important and need assistance from others in order to resolve their differences amicably
b) often arise from disagreements about how things should be done, how tasks should be divided up, what decisions should be made, etc. and can often escalate quickly if left unresolved
c) usually involve only two people and can easily be resolved without outside assistance if both parties are willing to work together towards a mutually acceptable solution
d) can only arise when people are angry with each other and feel like they need to express their anger through physical aggression

Question 6 3 points
Which of the following factors is NOT likely to contribute to an interpersonal conflict? Select all that apply.

a) previous bad experiences with one another

CRJS 6742 Week 2 MCQ’s (20 Multiple Choice Questions)

1. Which of the following is not an element of the conflict process?

a. Conflict escalation

b. Exit from the conflict

c. Conflict initiation

d. Conflict management

2. In order for a conflict to occur, which of the following must be present?

a. Two or more people

b. A perceivable difference in interests or goals between the parties involved

c. A feeling of frustration or dissatisfaction on the part of at least one party involved in the conflict

d. All of the above

3. Which of the following is an example of an interpersonal conflict?

a. A disagreement between two co-workers over who should take credit for a project they completed together

b. A dispute between a customer and a store manager over a refund for a defective product

c. A fight between two students in a school cafeteria

d. All of the above

4. In which stage of the conflict process do parties begin to communicate with one another about the conflict?

a. Awareness stage

b. Latent stage

c. Manifest stage
5. In which stage of the conflict process do parties begin to take action to resolve the conflict?

d. Resolution stage

CRJS 6742 Week 3 Description

The purpose of CRJS 6742 Course is to examine conflict and its resolution from various theoretical perspectives. The CRJS 6742 Course will cover such topics as the nature of conflict, communication and conflict, aggression and violence, international conflict, and the role of law in conflict resolution.

CRJS 6742 Week 3 Outline

Introduction to Conflict, Conflict Resolution, and Peace (CRJS 6742)

Instructor: Dr. Noelle Norton

Office: Social Sciences Building, Room 113-A

Office Hours: Monday/Wednesday 4:00-5:00pm or by appointment

CRJS 6742 Course Description: CRJS 6742 Course introduces students to the study of conflict, conflict resolution, and peace. The CRJS 6742 Course begins with an examination of the concept of conflict and the different approaches to understanding it. The second part of the CRJS 6742 Course looks at the various approaches to resolving conflict, with a focus on nonviolence and mediation. The final part of the CRJS 6742 Course explores the concept of peace and the different approaches to achieving it. Throughout the CRJS 6742 Course, students will have the opportunity to apply what they have learned to case studies of actual conflicts.

CRJS 6742 Course Objectives: By the end of CRJS 6742 Course, students will be able to:

1. Understand the concept of conflict and its importance in our lives;

2. Understand the different approaches to resolving conflict;

3. Understand the concept of peace and its importance in our world; and

4. Understand the different approaches to achieving peace.

CRJS 6742 Week 3 Objectives

1. Become familiar with various approaches to conflict and conflict resolution.

2. Understand the various dimensions of peace.

3. Develop skills in identifying and resolving conflict.

4. Understand the role of power in conflict and peace.

5. Learn about the impact of violence on individuals, families, and communities.

CRJS 6742 Week 3 Pre-requisites

CRJS 6742 – Conflict, Conflict Resolution, and Peace (5 credits) (CRJS 6742) Instructor’s Prerequisites CRJS 6742 – Conflict, Conflict Resolution, and Peace (5 credits) (CRJS 6742)

CRJS 6742 – Conflict, Conflict Resolution, and Peace (5 credits) (CRJS 6742) Required Materials Available through Brightspace

Available through Brightspace Grading Criteria Individual Assignment 30% Group Assignment 30% Final Exam 40%

CRJS 6742 Week 3 Duration

Conflict, Conflict Resolution, and Peace (5 credits) CRJS 6742 Course will explore the nature of conflict and provide an overview of various approaches to conflict resolution. Students will examine different approaches to conflict management including mediation, facilitation, arbitration, negotiation and collaborative problem solving. Students will also explore the role of third party intervention in resolving conflict. The CRJS 6742 Course will also address the relationship between conflict and violence as well as the role of power in resolving conflict.

CRJS 6742 Week 3 Learning Outcomes

1. Students will learn about conflict resolution processes and principles.

2. Students will learn about how to mediate conflicts effectively.

3. Students will learn about the role of peace in conflict resolution.

4. Students will be able to apply conflict resolution skills in various contexts.

5. Students will develop an understanding of the importance of conflict resolution for peacebuilding.

CRJS 6742 Week 3 Assessment & Grading

Introduction to Conflict and Conflict Resolution (Week 1) and Conflict, Conflict Resolution, and Peace (Week 2).

To complete this assignment, go to this week’s Assignment link in the left navigation.

Read the following scenario:

Scenario: You are working for a non-profit organization that is trying to reduce crime in your city. The organization has asked you to give a presentation on conflict and conflict resolution to a group of local business leaders. The presentation should last about 45 minutes. The presentation should include the following topics:

The definition of conflict and the different types of conflict

The different approaches to conflict resolution, including collaborative, competitive, and accommodative approaches

The different methods of conflict resolution, including mediation, arbitration, and negotiation

The different stages of conflict resolution, including diagnosis, agenda setting, information gathering, brainstorming, decision making, implementation, and evaluation

Your presentation should be well organized and supported with evidence from scholarly sources. Be sure to cite your sources using APA style.

CRJS 6742 Week 3 Suggested Resources/Books

CRJS 6742 Week 3 Suggested Resources/Books for CRJS 6742 – Conflict, Conflict Resolution, and Peace (5 credits) (CRJS 6742)

1. Moore, C. W. (1997). The mediation process: Practical strategies for resolving conflict (3rd ed.). Jossey-Bass.

2. Hocker, J. L., & Wilmot, W. W. (2005). Interpersonal conflict (7th ed.). McGraw-Hill Higher Education.

3. Deutsch, M., & Coleman, P. (2006). The handbook of conflict resolution: Theory and practice (2nd ed.). Jossey-Bass.

4. Zartman, I., & Faure, G. (2002). Collaborative approaches to conflict resolution in Africa: The Cases of Burundi, the Comoros Islands and Somalia (Vol. 1). United Nations University Press.

CRJS 6742 Week 3 Assignment (20 Questions)

Week 3 Assignment (20 Questions) for CRJS 6742 – Conflict, Conflict Resolution, and Peace (5 credits)

1. What are the three major types of conflict? How do they differ from each other?

2. What are the three major approaches to conflict resolution? How do they differ from each other?

3. What is the difference between a win-win, win-lose, and lose-lose approach to conflict resolution?

4. What are the five major steps in the conflict resolution process?

5. What are some of the key skills that are necessary for effective conflict resolution?

6. Why is it important to understand the interests of all parties involved in a conflict?

7. Why is it important to identify the underlying causes of a conflict?

8. What are some of the common barriers to effective communication?

9. What are some active listening techniques that can be used to improve communication during a conflict?

10. Why is it important to maintain a constructive attitude during a conflict?

11. What are some common methods of negotiation?

12. Why is it important to reach a mutually acceptable agreement during negotiation?

13. What are some common mistakes that people make during negotiation?

14. How can mediation be used to resolve a conflict?

15. What are some of the benefits of mediation?

CRJS 6742 Week 3 Assignment Question (20 Questions)

Please submit your answers to the questions below on a single document (5-7 pages). You may use additional resources to answer the questions but all references must be properly cited. The assignment will be graded according to the following: Organization of material (5 points)

Accuracy of information (10 points)

Quality of writing (5 points) Assignment Instructions: Answer each question completely and thoroughly. If a question does not apply, please indicate so with an “NA”. Be sure to answer each part of the question in sequence as indicated. Cite all sources used. All citation should conform to APA guidelines. Be concise in your responses and try not to exceed one page per question. Your answers should be submitted in a single Word or PDF file via D2L dropbox by 11:59 pm EST Sunday at the end of the Week 3 Module. Overview In this assignment, you will explore a variety of topics related to conflict and conflict resolution, including several theories and types of conflict, strategies for managing conflict, conflict styles, and factors that contribute to peace in society. Assessment Questions Note that each question has multiple parts which should be answered individually (see rubric). 1- What are some examples you have observed or experienced in your life where there was ethnic, racial, or religious bias? Can you think of any others? 2- Consider some examples from your own experience where individuals were in conflict because they had different value systems or expectations about how things should be done. What are some examples you have observed or experienced in your life where people disagreed about how things should be done? Can you think of any others? 3- Which style do you tend toward when involved in a dispute – avoidant, accommodating, competing, collaborative or compromising? When might it work best for you to use another style instead? 4- Consider some examples from your own experience where individuals were in conflict because they had different value systems or expectations about how things should be done. What are some examples you have observed or experienced in your life where people disagreed about how things should be done? Can you think of any others? 5- What do we mean when we say a person is transformational leader? 6- Describe what we mean by “conflict” and identify some common causes of conflict with specific examples. 7- There are many ways to assess what kind of leadership is required during an emergency situation like an earthquake or flood event; explain what kind of leadership would likely be most useful during such situations using specific examples. 8- Explain what is meant by “conflict management” and identify several approaches that can help manage conflicts more effectively using specific examples 9- When it comes to resolving conflict, there are generally two major approaches – problem solving and interest based negotiation – which approach do you prefer using and why using specific examples 10- Describe “task structure” as it relates to resolving conflicts; why is task structure important when assessing whether mediation might work for a particular dispute 11- Describe five possible outcomes that can result from mediation; which outcome do you feel would result most often given your experience 12- Why is it important for police officers who respond regularly to critical incidents like mass shootings or terrorist events take special care for their own mental health? 13- Define “critical incident stress debriefing” as it relates to police work 14- Define “problem oriented policing” as it relates specifically to reducing criminal violence 15- Explain why community policing strategies often focus on addressing neighborhood problems; include specific examples 16- How might police officers develop better relationships with community members using community policing strategies 17- Explain why restorative justice strategies have been shown effective among juvenile offenders 18 – How might police officers develop stronger relationships with juveniles through the use of restorative justice strategies 19 – Define “community watch” programs as they relate specifically to reducing crime 20 – How might police officers develop better relationships with community members through community watch programs CRJS 6742 Week 3 Assignment Question (20 Questions) for CRJS 6742 – Conflict, Conflict Resolution,…

CRJS 6742 Week 3 Discussion 1 (20 Questions)

1. Conflict occurs when there is a discrepancy in the goals or perceptions of two or more people. Describe how this can happen.

2. Conflict can be either constructive or destructive. Explain the difference between the two.

3. What are some of the common causes of conflict?

4. How can people manage conflict constructively?

5. Why is it important to resolve conflict?

6. What are some common methods for resolving conflict?

7. What are some of the challenges associated with resolving conflict?

8. How can mediation be used to resolve conflict?

9. What are some of the benefits of mediation?

10. What are some of the challenges associated with mediation?

CRJS 6742 Week 3 DQ 1 (20 Questions)

1. What is meant by the term conflict? How do you define conflict?
2. What is the difference between a conflict and a dispute?
3. What is the difference between a conflict and violence?
4. What are some of the different types of conflict?
5. What are some of the different approaches to conflict resolution?
6. Why is it important to resolve conflicts?
7. What are some of the challenges associated with resolving conflicts?
8. How can conflicts be prevented?
9. What are some of the things that can be done to reduce the impact of conflicts?
10. What is meant by the term “peace”? How do you define peace?
11. What are some of the different types of peace?
12. What are some of the different approaches to peacebuilding?
13. Why is it important to build peace?
14. What are some of the challenges associated with building peace?
15. How can peace be maintained?
16. What are some of the things that can be done to promote peace?
17. What is meant by the term “conflict resolution”? How do you define conflict resolution?
18. What are some of the different types of conflict resolution?
19. What are some of the different approaches to conflict resolution?
20. Why is it important to resolve conflicts?

CRJS 6742 Week 3 Discussion 2 (20 Questions)

CRJS 6742 Week 3 Discussion 2 (20 Questions) for CRJS 6742 – Conflict, Conflict Resolution, and Peace (5 credits) (CRJS 6742) Question 1: Do you think that the power-based perspective is more useful than the interest-based perspective when trying to explain conflict? Why or why not? Question 2: According to some, resource scarcity is a major source of conflict. Do you agree or disagree? Why or why not? Question 3: How do you think identity affects conflict? Question 4: How can emotional intelligence play a role in managing conflict? Question 5: What are the benefits and limitations of face-to-face negotiation in the conflict resolution process? Question 6: How can we use conflict resolution strategies to prevent violent conflict? Question 7: Should we always seek win-win solutions to conflict, or are there times when it may be better to pursue a win-lose solution? Explain your answer. Question 8: What can we learn from conflicts that occur in nature? Question 9: How does the Internet affect our ability to resolve conflicts? Question 10: Can games be used to teach people about conflict resolution? If so, how? If not, why not?

CRJS 6742 Week 3 DQ 2 (20 Questions)

What is a conflict? Give an example of a conflict you have experienced. How did you resolve the conflict?

Conflict is defined as a disagreement between two or more parties. An example of a conflict I have experienced is when I was assigned to work on a project with a coworker who I did not get along with. We had to resolve the conflict by communicating with each other and coming to a compromise.

CRJS 6742 Week 3 Quiz (20 Questions)

at Liberty University in the form of 20 Multiple Choice Questions.

The CRJS 6742 Course textbook is “Conflict: From Analysis to Intervention” by Dean T. Pruitt and Jeffrey Z. Rubin (5th edition).

1) The conflict management strategy of problem solving includes all of the following EXCEPT:

A) developing a clear understanding of the issues involved in the conflict.
B) analyzing the goals that each party to the conflict hopes to achieve.
C) evaluating the interests that each party to the conflict hopes to protect.
D) brainstorming possible ways to resolve the conflict.
E) generating a set of objective criteria for judging proposed solutions to the conflict.

2) According to their social-structural perspective, Cottrell and Witte believe that ________ is an important factor in understanding and managing conflict.

A) organizational culture
B) informal relationships among employees
C) communication patterns within work groups
D) structural elements of work organizations, such as authority relations, formal rules and procedures, and resource allocation systems
E) emotional intelligence among employees

3) According to their emotional intelligence perspective, Mayer, Salovey, and Caruso believe that ________ is an important factor in understanding and managing conflict.

A) organizational culture
B) informal relationships among employees
C) communication patterns within work groups
D) structural elements of work organizations, such as authority relations, formal rules and procedures, and resource allocation systems
E) emotional intelligence among employees

4) Which of the following is NOT one of the four basic strategies for managing conflict identified by Rahim?

A) avoidance
B) accommodation
C) problem solving
D) collaboration/cooperation/joint problem solving/integration/win-win/empathizing with the other side/ mutual gains approach/interest-based or needs-based negotiation/ integrative bargaining/distributive bargaining/batch negotiation/sequential negotiation/pluralistic negotiation /transformative mediation/ shuttle diplomacy/conciliation/ arbitration/ adjudication / judicial settlement / trial by jury / mini-trial / fact-finding / interest based or needs based negotiation / mediation-arbitration / mediation-arbitration-conciliation / multi-option dispute resolution / collaborative law / restorative justice
E) competition or win-lose or zero sum or distributive bargaining or claim negotiation

5) All of the following are true about Thomas Kilmann’s five conflict management modes EXCEPT:

A) Withholding information is an example of avoiding conflict.
B) Giving in is an example of accommodating conflict.
C) Brainstorming is an example of problem solving conflict.
D) Forcing is an example of competing conflict.
E) Smoothing over differences is an example of compromising conflict.

6) According to Rahim, which one of the following represents a win-win orientation?

A avoidance B accommodation C problem solving D competition E compromise F collaboration G joint problem solving H integration I win-win J empathizing with the other side K mutual gains approach L interest-based or needs-based negotiation M integrative bargaining N distributive bargaining O batch negotiation P sequential negotiation Q pluralistic negotiation R transformative mediation S shuttle diplomacy T conciliation U arbitration V adjudication W judicial settlement X trial by jury Y mini-trial Z fact-finding AA interest based or needs based negotiation AB mediation-arbitration AC mediation-arbitration-conciliation AD multi-option dispute resolution AE collaborative law AF restorative justice

7 Which one of Kilmann’s five modes do you think would be most effective when you need your team members to pool their knowledge and come up with some new ideas?

A avoidance B accommodation C problem solving D competition E compromise F collaboration G joint problem solving H integration I win-win J empathizing with the other side K mutual gains approach L interest-based or needs-based negotiation M integrative bargaining N distributive bargaining O batch negotiation P sequential negotiation Q pluralistic negotiation R transformative mediation S shuttle diplomacy T conciliation U arbitration V adjudication W judicial settlement X trial by jury Y mini-trial Z fact-finding AA interest based or needs based negotiation AB mediation-arbitration AC mediation-arbitration-conciliation AD multi-option dispute resolution AE collaborative law AF restorative justice

8 Which one of Kilmann’s five modes do you think would be most effective when you have been asked to mediate a dispute between two other people?

A avoidance B accommodation C problem solving D competition E compromise F collaboration G joint problem solving H integration I win-win J empathizing with the other side K mutual gains approach L interest-based or needs-based negotiation M integrative bargaining N distributive bargaining O batch negotiation P sequential negotiation Q pluralistic negotiation R transformative mediation S shuttle diplomacy T conciliation U arbitration V adjudication W judicial settlement X trial by jury Y mini-trial Z fact-finding AA interest based or needs based negotiation AB mediation-arbitration AC mediation-arbitrationconciliation AD multioption dispute resolution AE collaborative law AF restorative justice

9 In their book on emotional intelligence, Mayer, Salovey, and Caruso suggest that people high in empathy are more likely to do all of the following EXCEPT:

A understand another person’s feelings and perspectives B respond effectively to another person’s emotions C be aware of their own emotions D use emotions to facilitate thought E have difficulty seeing both sides of a disagreement F feel personally responsible for resolving conflicts between others G have difficulty empathizing with people from cultures different from their own H see emotions as helpful guides for decision making I use emotions to motivate themselves J become defensive when someone criticizes them K react impulsively when they feel threatened L be more likely than others to experience burnout M maintain healthier relationships than others N cope better than others with stress O be more resilient than others in the face of adversity P be more likely than others to experience job satisfaction Q be more engaged than others in their work R have higher levels of job performance than others S earn more money than others over the CRJS 6742 Course of their careers T enjoy better physical health than others U live longer than others V die younger than others W experience more positive emotions throughout their lives X experience fewer negative emotions throughout their lives Y report higher levels of happiness than others Z report higher levels of satisfaction with life AA report higher levels of meaning and purpose in life AB report higher levels on measures of selfesteem AC report higher levels on measures of selfefficacy AD report higher levels on measures creativity AE have brains that are structurally different from those of people low in empathy AF are better able than people low in empathy to put themselves in another person’s shoes AG are better able than people low in empathy to read other people’s nonverbal cues AH are better able than people low in empathy to regulate their emotions AI are better able than people low in empathy AJ are better able than people low in empathy AK are better able than people low in empathy AL are better able than people low in empathy AM have parents who were more emotionally supportive than those of people low in empathy AN have parents who were less emotionally supportive than those of people low in empathy AO were raised in families that were more loving and cohesive than those of people low in empathy AP were raised in families that were less loving and cohesive than those parties who did not trust each other

CRJS 6742 Week 3 MCQ’s (20 Multiple Choice Questions)

Question 1

1. Mediation, arbitration, facilitation and negotiation are all examples of _______.

A) interest-based conflict resolution processes
B) problem-solving approaches to conflict resolution
C) third-party conflict resolution processes
D)both A and B

C) third-party conflict resolution processes

CRJS 6742 Week 4 Description

In CRJS 6742 Course, students will explore the nature and causes of conflict, as well as the various methods used to resolve conflict and promote peace. Students will examine a variety of case studies involving interpersonal, inter-group, and international conflict, and will have the opportunity to apply the concepts and principles learned in the CRJS 6742 Course to real-world situations.

CRJS 6742 Week 4 Outline

Week 4: Conflict and Reconciliation in the Digital Age

In this lesson, we’ll learn about the effects of digital media on conflict and reconciliation. We’ll begin with a look at how the Internet and social media are used during times of conflict, and we’ll explore some of the advantages and disadvantages of using these technologies. We’ll then turn to the role of digital media in post-conflict reconciliation, and we’ll consider how social media can be used to promote peace. Finally, we’ll discuss some of the ethical considerations involved in using digital media during times of conflict and reconciliation.

CRJS 6742 Week 4 Objectives

1. To examine the causes and consequences of conflict;

2. To explore a variety of methods for managing and resolving conflict;

3. To analyze the role of various actors in promoting peace; and

4. To develop strategies for preventing and responding to conflict.

CRJS 6742 Week 4 Pre-requisites

Students must be enrolled in a master’s degree program at the George Mason University School of Law.

CRJS 6742 Week 4 Duration

CRJS 6751 Conflict Resolution Methods (5 credits)

CRJS 6742 Week 7 Duration for CRJS 6751 – Conflict Resolution Methods (5 credits) (CRJS 6751)

In total, the program is expected to take approximately 30 weeks to complete, though this will vary depending on the level of study and other factors. Students are able to complete the CRJS 6742 Courses at their own pace, with up to two years to finish each CRJS 6742 Course. The program must be completed within four years from the date of admission.

CRJS 6742 Week 4 Learning Outcomes

Students who successfully complete CRJS 6742 – Conflict, Conflict Resolution, and Peace (5 credits) will be able to:

1. Understand the nature of conflict and its impact on individuals, groups, and societies.

2. Understand the various approaches to conflict resolution and their applicability to different types of conflicts.

3. Analyze the role of power in conflicts and in conflict resolution processes.

4. Understand the dynamics of violence and its impact on individuals, groups, and societies.

5. Analyze the causes of violent conflict and identify strategies for prevention and resolution.

CRJS 6742 Week 4 Assessment & Grading

1. CRJS 6742 Course Assessment and Grading

The purpose of CRJS 6742 Course is to provide students with a critical understanding of conflict, conflict resolution, and peace. Students will be assessed on their ability to critically analyze and apply CRJS 6742 Course concepts to real-world situations. Students will be graded on a scale of 0-100. The following table outlines the assessment tasks and associated weighting for the CRJS 6742 Course:

Assessment Task Weighting CRJS 6742 Coursework 1 25% CRJS 6742 Coursework 2 25% Final Exam 50%

CRJS 6742 Coursework 1 and 2 will each be worth 25% of the final grade. The final exam will be worth 50% of the final grade.

2. CRJS 6742 Coursework Assessments

CRJS 6742 Coursework 1 and 2 will each be worth 25% of the final grade. CRJS 6742 Coursework 1 will assess students’ ability to critically analyze and apply CRJS 6742 Course concepts to real-world situations. CRJS 6742 Coursework 2 will assess students’ ability to critically analyze and apply CRJS 6742 Course concepts to real-world situations.

CRJS 6742 Week 4 Suggested Resources/Books

CRJS 6742 Week 4 Suggested Resources/Books for CRJS 6742 – Conflict, Conflict Resolution, and Peace (5 credits) (CRJS 6742)

PLDZ-1917

In Stock $ 15.00 USD Bright Solutions

Conflict is everywhere. We have conflicts with our bosses, friends, families, spouses, children, and even strangers. This conflict is a result of our differences in opinions and ideas. The conflict may be verbal or nonverbal; it may be violent or nonviolent; and it may be overt or covert. In any case, conflict is an inevitable part of life.

The purpose of this assignment is for you to select two books about conflict resolution from the suggested resources below or from the Library databases. Then write a review on each book in 500 words or more that includes the following:

A brief summary of the author’s thesis/argument that explains what the author believes causes conflict and how to resolve that conflict. Be sure to cite specific examples from the book to support your position.

Your evaluation of how successful you believe the author was at explaining his/her argument about conflict resolution including your views on whether or not you agree with his/her conclusions. Include specific examples from the book to support your position.

An explanation of how this book might be useful to a professional mediator as well as an individual who finds him/herself in a personal dispute with another person such as a boss or spouse.

Conflict is everywhere. We have conflicts with our bosses, friends, families, spouses, children, and even strangers. This conflict is a result of our differences in opinions and ideas. The conflict may be verbal or nonverbal; it may be violent

CRJS 6742 Week 4 Assignment (20 Questions)

(CRJS 6742)

Complete the following assignment, using information from the Lecture 4 materials and your required readings. Please note that this is not a research paper; your answers should be based on information provided in the Lecture 4 materials and your required readings. Your assignment should be between 750-1000 words. Please submit your assignment as a Microsoft Word document.

Assignment: Case Study Analysis

Read Case Study #3 on pages 83-84 of Conflict Resolution Theory and Practice by Crocker, Hampson, and Auld (2011). Then, answer each of the following questions:

1. How do you think the conflict might have been prevented? How could Aaron have managed his anger more effectively? What could Mary have done differently to manage her anxiety?
2. What specific conflict resolution skills or strategies (e.g., active listening, I-messages, collaborative problem solving, etc.) do you think would have been helpful in this situation? Explain your answer.
3. Based on what you know about the situation, do you think that mediation would have been an effective way to resolve the conflict? Why or why not? Be specific in your answer.
4. Do you think that Aaron and Mary would benefit from attending a conflict resolution training program? Why or why not? What specific skills or strategies do you think they would learn in such a program that would help them to resolve their conflict? Explain your answer.

CRJS 6742 Week 4 Assignment Question (20 Questions)

1. How do different perspectives on conflict affect the way that people understand and respond to it?

2. How does the concept of conflict resolution differ from traditional approaches to managing conflict?

3. What are some of the key skills and strategies associated with effective conflict resolution?

4. How can an understanding of conflict theory help us to better manage conflicts in our personal and professional lives?

5. What are some of the challenges associated with resolving conflicts at the international level?

6. How can mediation and other third-party interventions be used to effectively resolve conflicts?

7. What role does communication play in managing and resolving conflicts?

8. How can cultural differences affect the way we perceive and respond to conflict?

9. What impact do gender differences have on the way we experience and resolve conflict?

10. What are some of the unique challenges associated with resolving conflicts within families?

CRJS 6742 Week 4 Discussion 1 (20 Questions)

1) How can we distinguish between various types of conflict and the methods that are best used to resolve them?

2) What is the difference between a conflict and a dispute? When is it appropriate to use each term?

3) How can we identify the different types of conflict that may arise in relationships?

4) What are some of the methods that can be used to resolve conflict within relationships?

5) What is the difference between constructive and destructive conflict? When is it appropriate to use each type of conflict resolution method?

6) How can we identify when a conflict has become too heated or out of control?

7) What are some effective methods for cooling down a heated conflict?

8) What are some common mistakes that people make when attempting to resolve conflict?

9) How can we avoid making these mistakes when resolving conflict?

10) What are some effective ways to prevent or reduce the occurrence of future conflicts?

CRJS 6742 Week 4 DQ 1 (20 Questions)

What is the definition of conflict? What are some examples of conflict in your life?

Conflict is defined as a situation in which people have incompatible goals or ideas. Examples of conflict in my life include disagreements with friends or family members, difficulty completing tasks at work, and competition with others.

How does conflict arise?

Conflict arises when people have incompatible goals or ideas. For example, conflict may arise if two people want to use the same resources or if they have different opinions about something.

What are some of the consequences of conflict?

The consequences of conflict can be positive or negative. Positive consequences may include increased creativity and problem-solving ability. Negative consequences may include decreased productivity, decreased satisfaction, and increased stress levels.

What are some ways to prevent or resolve conflict?

Some ways to prevent or resolve conflict include communication, compromise, and mediation.

CRJS 6742 Week 4 Discussion 2 (20 Questions)

1. Why is peace important?

2. What is the difference between conflict and violence?

3. How can conflict be resolved without resorting to violence?

4. What are some common causes of conflict?

5. How can we prevent or reduce conflict?

6. How can we better manage or resolve existing conflicts?

7. What are some of the challenges associated with peacebuilding?

8. What are some successful examples of peacebuilding?

9. How can the media help promote peace?

10. What is the role of education in promoting peace?

CRJS 6742 Week 4 DQ 2 (20 Questions)

Please answer the following questions:

1. What are some of the major differences between mediation and arbitration?

2. Why is it important to understand these differences?

3. What are some of the benefits of mediation?

4. What are some of the benefits of arbitration?

5. What are some of the drawbacks of mediation?

6. What are some of the drawbacks of arbitration?

7. When might mediation be a better option than arbitration?

8. When might arbitration be a better option than mediation?

9. What are some of the key skills necessary for successful mediation?

10. What are some of the key skills necessary for successful arbitration?

CRJS 6742 Week 4 Quiz (20 Questions)

1. Which of the following is NOT a common conflict resolution strategy?

a) positive reinforcement b) punitive action c) mediation d) conflict resolution

2. What is a fundamental characteristic of a zero-sum game?

a) there are no winners or losers b) there are multiple winners and losers c) one party’s gain is another party’s loss d) all of the above

3. Which of the following statements about emotions in conflict is NOT true?

a) emotions can be contagious b) negative emotions tend to escalate conflict c) anger is the most common emotion in conflict d) emotions can cloud judgment

4. Which of the following is NOT an example of an indirect cost of conflict?

a) lost productivity b) increased absenteeism c) decreased job satisfaction d) increased employee turnover

5. __________ is the process by which people learn to manage their emotions and interact with others in ways that maintain relationships and avoid or resolve conflict.

a) Emotional intelligence b) Social intelligence c) Conflict management d) Relationship management

6. According to the Thomas-Kilmann Conflict Mode Instrument, __________ is a win-lose approach to conflict in which one party tries to force its solution on the other party.

a) avoidance b) competition c) accommodation d) collaboration

7. According to the Thomas-Kilmann Conflict Mode Instrument, __________ is a win-win approach to conflict in which parties work together to find a solution that meets their needs.

a) avoidance b) competition c

CRJS 6742 Week 4 MCQ’s (20 Multiple Choice Questions)

– Dr. Kimble (University of Oklahoma)

Note: CRJS 6742 Course is a graduate-level class.

CRJS 6742 Week 5 Description

CRJS 6742 Course explores how conflict and violence are integral parts of the human experience. We will examine the nature of conflict, its causes and consequences, as well as various approaches to conflict resolution. The CRJS 6742 Course will provide students with an opportunity to critically examine different perspectives on conflict and peace.

CRJS 6742 Week 5 Outline

Week 5:
1. Introduction to Conflict Resolution and Peace Studies
2. Approaches to Conflict Resolution
3. Theories of Peace
4. Case Studies in Conflict Resolution and Peace

CRJS 6742 Week 5 Objectives

Week 5 Objectives for CRJS 6742 – Conflict, Conflict Resolution, and Peace (5 credits)

1. Understand the major theories of conflict and conflict resolution.

2. Analyze the role of conflict in society.

3. Understand the process of conflict resolution.

4. Understand the role of mediation in conflict resolution.

5. Understand the role of arbitration in conflict resolution.

CRJS 6742 Week 5 Pre-requisites

CRJS 6741 – Conflict, Conflict Resolution, and Peace (4 credits)

CRJS 6742 Course is designed to provide students with a theoretical and practical understanding of conflict, its causes, consequences, and potential for resolution. The CRJS 6742 Course will cover the major approaches to the study of conflict and peace, including those from the social sciences, psychology, law, and international relations. Case studies of conflicts around the world will be used to illustrate various concepts.

CRJS 6742 Week 5 Duration

CRJS 6742 Course is 5 weeks long.

CRJS 6742 Week 5 Learning Outcomes

• Compare and contrast various conflict resolution theories.

• Analyze the impact of conflict on individuals, organizations, and societies.

• Evaluate the effectiveness of various conflict resolution interventions.

• Design and implement a conflict resolution intervention plan.

• Assess the role of culture in conflict and conflict resolution.

CRJS 6742 Week 5 Assessment & Grading

CRJS 6742 Week 5 Assessment & Grading for CRJS 6742 – Conflict, Conflict Resolution, and Peace (5 credits) (CRJS 6742)

CRJS 6742 Week 5 Suggested Resources/Books

I have no suggestions for CRJS 6742 Conflict, Conflict Resolution, and Peace.

CRJS 6742 Week 5 Assignment (20 Questions)

(Spring 2021)

**Instructor: Dr. Rebecca L. Stoltzfus**

**CRJS 6742 Course Description:** In CRJS 6742 Course we will focus on the relationships among conflict, conflict resolution and peace. We will examine the nature of conflict, the methods available to resolve it, as well as the effects of unresolved conflict in human societies. We will consider various perspectives on conflict resolution including psychological, sociological, anthropological, and political approaches to understanding and resolving interpersonal and international disputes. Finally, we will explore how violence and nonviolence can be used as strategies for dealing with difficult situations. Through readings and discussions, students will develop a better understanding of the nature of conflict and its impact on individuals and society. Students will also learn how to identify appropriate interventions for resolving particular conflicts. The CRJS 6742 Course is organized around five modules: Module 1 – Defining Conflict; Module 2 – Causes of Conflict; Module 3 – Violence in Conflict; Module 4 – Resolving Conflict; Module 5 – Peacebuilding in Conflict-Affected Societies

**CRJS 6742 Course Schedule:**

CRJS 6742 – Conflict, Conflict Resolution, and Peace (5 credits)

Instructor: Dr. Rebecca L. Stoltzfus

Spring 2021

CRJS 6742 – CRJS 6742 Course Schedule

*All readings are located in the CRJS 6742 Course Resources section of your D2L Brightspace CRJS 6742 Course site.*

Module | Date/s | Assignment Due Date(s) | Assignment
| — | — | — | — | — | —|
| 1 | January 25 – February 1 | February 8 by 11:59pm EST | 20 Questions (Week 5 Assignment) |
| 2 | February 2 – 8 | February 15 by 11:59pm EST | No assignment due |
| 3 | February 9 – 15 | February 22 by 11:59pm EST | No assignment due || 4 | February 16 – 22 | March 1 by 11:59pm EST || 5 | February 23 – March 1 || Final Exam period || 6 & 7& 8 || Spring Break || Final Exam Week || Final Exam Week || Final Exam Week || Final Exam Week

**Assignment Description:** For this assignment you will choose 20 questions out of 40 possible questions that you think would be good questions for an exam over Modules 1-4 in our CRJS 6742 Course text Organizing for Peace in Syria by Mary B. Anderson & Elizabeth L. Sawicki (see link below). You may use any combination of questions from Modules 1-4 but you must use at least 10 questions from each module (1-4). Your answers should be specific enough to address the question but not so long that they could be used as answers to an essay exam question on one of our exam weeks (final exam week or during regular class time). You may want to refer back to some of your quiz answers or lecture notes for help with your responses to these questions but make sure that your responses reflect what you have learned since taking those quizzes/notes as this assignment is worth more than a quiz grade is worth! Also make sure that you do not just copy/paste your previous quiz responses into this assignment without editing them first! Copying/pasting without editing is plagiarism! You are strongly encouraged to discuss these questions with each other before submitting your final product but your submission should be your own work only so please don’t simply take someone else’s answers off D2L Brightspace discussion boards or Google Docs etc. This activity is meant for you to review what we have covered so far in our CRJS 6742 Course together via the text reading assignments we have completed since we last had a test/exam over Modules 1-3 together at the beginning of Module 4 (see schedule above). You are encouraged to discuss these questions with each other online but please remember that if you collaborate with others online that you need to submit your own individual work only when uploading it into D2L Brightspace! This is not a group project! I do NOT want submissions via email or hardcopy mailed/delivered through campus mail etc., nor do I want submissions pasted into discussion boards on D2L Brightspace either!! Only upload into D2L Brightspace where I can see who submitted what version etc., thanks! This activity makes up 20% of your grade for CRJS 6742 Course so please make sure that you spend enough time reviewing our CRJS 6742 Course content before submitting this assignment into D2L Brightspace where I can see when it was last edited etc., thanks!! If you have any further questions about this activity or need help accessing or downloading any required documents for this activity please let me know ASAP so I can help out!! Good luck!! : )

**Requirements:** To successfully complete this activity you must answer all 20 questions fully within the body text box provided when submitting into D2L Brightspace where I can see who submitted what version etc., thanks! Please remember that if you collaborate with others online that you need to submit your own individual work only when uploading it into D2L Brightspace! This is not a group project! Submissions via email or hardcopy mailed/delivered through campus mail etc., are NOT acceptable nor are submissions pasted into discussion boards on D2L Brightspace either!! Only upload into D2L Brightspace where I can see who submitted what version etc., thanks! Please remember that if you collaborate with others online during this activity that you need to submit your own individual work only when uploading it into D2L Brightspace here at the end of Module 4 (see schedule above)! This is not a group project! The submission deadline for this activity is Sunday March 7th at 11:59pm EST so make sure you give yourself enough time before then to log back into D2L Brightspace where we started our CRJS 6742 Course together back in January 2021 so that I can see who submitted what version etc., thanks!! If any technical problems occur while trying to access or download any required documents for this activity please let me know ASAP so I can help out!! : ) There is no late work accepted after Sunday March 7th at 11:59pm EST due date has passed without exception so please plan accordingly!!! Good luck!! : ) Thanks again!! : )

**Additional Resources Needed For Completing Assignment In Full And On Time** [Organizing for Peace in Syria](https://www.amazon.com/Organizing-Peace-Syria-Mary-Anderson/dp/0804797954) ISBN # 978-0804797952 Author(s): Mary B. Anderson & Elizabeth L. Sawicki Publication Date: 2015 Publisher Name: Stanford University Press Street Address For Publisher Office: 1450 Page Mill Road Stanford California United States 94305 Phone Number For Publisher Office In USA Only (XXX)-XXX-XXXX Website URL Link For Publisher Office http://www./stanfordpress./stanfordpress./index./html Email Address For Contacting Publisher support@stanfordpress./stanfordpress./com Access Code And/Or Password Information For Required Textbook Or Other Learning Resources Needed None Required Additional Readings Or Other Learning Resources Needed Besides Required Textbook None Required Length Of Assignment 3 pages double spaced 12 pt Times New Roman font Due Date Of Assignment Sunday March 7th at 11:59pm Eastern Standard Time Zone Point Value Of Assignment Worth 20% Of Your Grade For CRJS 6742 Course Percentage Of CRJS 6742 Course Grade Contributed By This Assignment 20% late policy Late assignments are NOT accepted without exception !!!!! Plagiarism Policy All assignments must be completed individually unless otherwise specified in writing by instructor!!! Cheating On Any Assignment Is Not Tolerated!!! All cheating incidents will be reported immediately per University policy!!!!! Academic Integrity Violations Are Subject To Serious Consequences Including Failing The CRJS 6742 Course And Being Reported To The Registrar’s Office Per University Policy!!!!!!!!! Collaboration Policy Collaboration Is Strongly Encouraged Unless Otherwise Specified In Writing By Instructor!!!!!!!!!!!! Extra Credit Opportunities Available? Yes If So Please Describe Opportunity And Point Value BelowExtra Credit Opportunities Available? Yes If So Please Describe Opportunity And Point Value Below None Available

**Question Choices For Your Consideration From Modules 1-4 Of Our CRJS 6742 Course Text Organizing For Peace In Syria By Mary B. Anderson & Elizabeth L. Sawicki ISBN # 978-0804797952** [Organizing for Peace in Syria](https://www.amazon.com/Organizing-Peace-Syria-Mary-Anderson/dp/0804797954) ISBN # 978-0804797952 Author(s): Mary B. Anderson & Elizabeth L. Sawicki Publication Date: 2015 Publisher Name: Stanford University Press Street Address For Publisher Office: 1450 Page Mill Road Stanford California United States 94305 Phone Number For Publisher Office In USA Only (XXX)-XXX-XXXX Website URL Link For Publisher Office http://www./stanfordpress./stanfordpress./index./html Email Address For Contacting Publisher support@stanfordpress./stanfordpress./com Access Code And/Or Password Information For Required Textbook Or Other Learning Resources Needed None Required Additional Readings Or Other Learning Resources Needed Besides Required Textbook None Required Length Of Assignment 3 pages double spaced 12 pt Times New Roman font Due Date Of Assignment Sunday March 7th at 11:59pm Eastern Standard Time Zone Point Value Of Assignment Worth 20% Of Your Grade For CRJS 6742 Course Percentage Of CRJS 6742 Course Grade Contributed By This Assignment 20% late policy Late assignments are NOT accepted without exception !!!!! Plagiarism Policy All assignments must be completed individually unless otherwise specified in writing by instructor!!! Cheating On Any Assignment Is Not Tolerated!!! All cheating incidents will be reported immediately per University policy!!!!! Academic Integrity Violations Are Subject To Serious Consequences Including Failing The CRJS 6742 Course And Being Reported To The Registrar’s Office Per University Policy!!!!!!!!! Collaboration Policy Collaboration Is Strongly Encouraged Unless Otherwise Specified In Writing By Instructor!!!!!!!!!!!! Extra Credit Opportunities Available? Yes If So Please Describe Opportunity And Point Value BelowExtra Credit Opportunities Available? Yes If So Please Describe Opportunity And Point Value Below None Available

### Questions From Module 1 Defining Conflict Chapter 3 A Framework for Understanding Conflict pp 57 – 92 In Organizing for Peace in Syria By Mary B . Anderson & Elizabeth L . Sawicki ISBN # 978 – 0804797952 ### [Organizing for Peace in Syria](https://www . amazon . com / Organizing – Peace – Syria – Mary – Anderson / dp / 0804797954) ISBN # 978 – 0804797952 Author(s): Mary B . Anderson & Elizabeth L . Sawicki Publication Date : 2015 Publisher Name : Stanford University Press Street Address For Publisher Office : 1450 Page Mill Road Stanford California United States 94305 Phone Number For Publisher Office In USA Only XXXX XXX XXXX Website URL Link For Publisher Office http:/ / www ./ stanfordpress ./ stanfordpress ./ index ./ html Email Address For Contacting Publisher support@stanfordpress ./ stanfordpress ./ com Access Code And / Or Password Information For Required Textbook Or Other Learning Resources Needed None Required Additional Readings Or Other Learning Resources Needed Besides Required Textbook None Required Length Of Assignment 3 pages double spaced 12 pt Times New Roman font Due Date Of Assignment Sunday March 7th at 11 : 59pm Eastern Standard Time Zone Point Value Of Assignment Worth 20 % Of Your Grade For CRJS 6742 Course Percentage Of CRJS 6742 Course Grade Contributed By This Assignment 20 % late policy Late assignments are NOT accepted without exception ! ! ! ! ! ! Plagiarism Policy All assignments must be completed individually unless otherwise specified in writing by instructor ! ! ! ! Cheating On Any Assignment Is Not Tolerated ! ! ! All cheating incidents will be reported immediately per University policy ! ! ! ! Academic Integrity Violations Are Subject To Serious Consequences Including Failing The CRJS 6742 Course And Being Reported To The Registrar ’ s Office Per University Policy ! ! ! ! ! Collaboration Policy Collaboration Is Strongly Encouraged Unless Otherwise Specified In Writing By Instructor ! ! ! Extra Credit Opportunities Available ? Yes If So Please Describe Opportunity And Point Value BelowExtra Credit Opportunities Available ? Yes If So Please Describe Opportunity And Point Value Below None Available
#### Question Choice One From Module One Chapter Three A Framework for Understanding Conflict pp 57 – 92##### What does it mean when we say “conflict is natural” ? What examples from daily life illustrate this point ? Can conflict ever be avoided ? Why or why not ?#### Question Choice Two From Module One Chapter Three A Framework for Understanding Conflict pp 57 – 92##### How might an appreciation of diversity help prevent or reduce conflict ? Give an example from daily life , literature , movies , television , news , history , current events , personal experience , etc . , which illustrates how an appreciation of diversity might prevent or reduce conflict .#### Question Choice Three From Module One Chapter Three A Framework for Understanding Conflict pp 57 – 92##### Explain what is meant by an “escalatory spiral” using an example from daily life , literature , movies , television , news , history , current events , personal experience , etc . How might an understanding of escalatory spirals help people avoid or resolve conflict ?#### Question Choice Four From Module One Chapter Three A Framework for Understanding Conflict pp 57 – 92##### Explain how different types of communication contribute to or reduce misunderstanding and conflict using examples from daily life , literature , movies , television , news , history , current events , personal experience , etc . Which types of communication do you find most helpful when communicating with others ? Why ?#### Question Choice Five From Module One Chapter Three A Framework for Understanding Conflict pp 57 – 92##### Explain why misperceptions often lead people into misunderstandings and conflict using examples from daily life literature movies television news history current events personal experience etc Which type s of misperception do you find most common among people today Why ?#### Question Choice Six From Module One Chapter Three A Framework for Understanding Conflict pp 57 92 ##### What effect does stress have on people ’ s ability to communicate effectively Why might stress increase during periods of heightened conflict What types s of coping mechanisms might people use during such times How effective are they usually Explain using examples from daily life literature movies television news history current events personal experience etc ##### Question Choice Seven From Module One Chapter Three A Framework for Understanding Conflict pp 57 92 ##### What effect does emotional reactivity have on people ’ s ability communicate effectively Give an example from daily life literature movies television news history current events personal experience etc which illustrates emotional

CRJS 6742 Week 5 Assignment Question (20 Questions)

– 2019 Spring (CY)

What is the “social contract” and how does it influence the process of conflict resolution? (1.5 points) The social contract is a set of agreements between individuals that establish expectations for behavior. These agreements are typically unwritten and understood by the members of a society. The social contract can influence the process of conflict resolution by setting out the expectations for how people should behave in a given situation. If the social contract is clear and concise, it can help to prevent or resolve conflict by providing a common understanding of what is acceptable behavior. However, if the social contract is unclear or conflicting, it can lead to confusion and conflict. 2. What are some of the key features of an effective conflict resolution process? (1.5 points) Some key features of an effective conflict resolution process include: – Establishing clear communication channels – Encouraging open and honest communication – Allowing all parties to express their views and needs – Facilitating active listening – Seeking creative solutions that meet the needs of all parties involved – Encouraging mutual respect and cooperation – Monitoring and evaluating progress 3. What are some common obstacles to effective conflict resolution? (1.5 points) Some common obstacles to effective conflict resolution include: – Lack of communication – Miscommunication – Different goals and objectives – Limited resources – Emotional reactions – Power imbalances 4. Describe the five steps of the collaborative problem-solving model. (1 point) The five steps of the collaborative problem-solving model are: 1. Define the problem 2. Brainstorm potential solutions 3. Evaluate potential solutions 4. Select the best solution 5. Implement and evaluate the solution 5. What are some advantages and disadvantages of mediation? (1 point) Advantages of mediation include: – All parties have an opportunity to be heard – Mediation can provide a confidential setting in which to discuss sensitive issues – Mediation can help to reduce hostility and tension between parties Disadvantages of mediation include: – Mediation may not be appropriate for all types of disputes – Mediation requires all parties to be willing to negotiate in good faith – Mediation may not result in a resolution that is satisfactory to all parties 6. What are some advantages and disadvantages of arbitration? (1 point) Advantages of arbitration include: – Arbitration can be faster and less expensive than going to court – Arbitration is typically binding, which means that the decision of the arbitrator is final and cannot be appealed Disadvantages of arbitration include: – Arbitration may not be appropriate for all types of disputes – Arbitration requires all parties to be willing to negotiate in good faith – Arbitration may not result in a resolution that is satisfactory to all parties 7. What are some advantages and disadvantages of negotiation? (1 point) Advantages of negotiation include: – All parties have an opportunity to be heard – Negotiation can help to reduce hostility and tension between parties Disadvantages of negotiation include:

CRJS 6742 Week 5 Discussion 1 (20 Questions)

Directions: Please read the following two scenarios and answer the questions below. Be sure to answer all parts of each question. Your initial post should be at least 250 words in length. Respond to at least two other students’ posts by Day 7.

Scenario 1

You are a certified mediator working for a non-profit mediation organization that provides mediation services for parties involved in family, civil, and community disputes. You are assigned to mediate between a married couple who has filed for divorce but is willing to try mediation first before going through the court system. When you meet with the couple, they tell you that they have decided not to continue with mediation because they believe it will be too difficult and they are not ready to work together yet. They say they need more time apart before they can resolve their issues through mediation.

What are your next steps? What would you do differently if the couple had decided to stay in mediation? How might this scenario have been prevented?

Scenario 2

You are a certified mediator working for a non-profit mediation organization that provides mediation services for parties involved in family, civil, and community disputes. You are assigned to mediate between a married couple who has filed for divorce but is willing to try mediation first before going through the court system. When you meet with the couple, they tell you that they have decided not to continue with mediation because one of them does not want to be there and is only doing it to please the other spouse. They say they will try again when they are both ready and willing to work together.

What are your next steps? What would you do differently if the couple had decided to stay in mediation? How might this scenario have been prevented?

CRJS 6742 Week 5 DQ 1 (20 Questions)

1. Describe the role of conflict resolution in society.

2. How does conflict resolution contribute to the maintenance of social order?

3. What are some of the benefits of conflict resolution?

4. How can conflict resolution help to prevent or resolve conflicts?

5. What are some of the challenges associated with conflict resolution?

6. What are some of the key skills necessary for effective conflict resolution?

7. How can conflict resolution be used to build peace?

8. What are some of the challenges associated with using conflict resolution to build peace?

9. How can conflict resolution be used to prevent or resolve violence?

10. What are some of the challenges associated with using conflict resolution to prevent or resolve violence?

CRJS 6742 Week 5 Discussion 2 (20 Questions)

(CRJS 6742)

1. Please describe how a conflict between a father and son can be resolved using facilitation. Please include a discussion of the role of emotion in facilitation.

2. How can mediation be used to resolve a conflict between a father and son? Please include a discussion of the role of emotion in mediation.

3. How can arbitration be used to resolve a conflict between a father and son? Please include a discussion of the role of emotion in arbitration.

4. What are some of the benefits of using negotiation to resolve a conflict between a father and son? Please include a discussion of the role of emotion in negotiation.

5. What are some of the challenges that may arise when using negotiation to resolve a conflict between a father and son? Please include a discussion of the role of emotion in negotiation.

CRJS 6742 Week 5 DQ 2 (20 Questions)

If you are looking for someone to help you complete this work, contact us at HomeworkBazaar.com

What is the historical origin of conflict resolution? What is its philosophical basis? Discuss how conflict resolution as a field has developed over time. How do the various approaches to conflict resolution relate to one another? What are the strengths and weaknesses of each approach?

How does your personal conflict resolution style compare to the four basic approaches discussed in your text? Which do you think best describes your natural tendencies when dealing with conflict, and why? Be specific in describing your own conflict resolution style, and provide an example of how you might use it in a real-world situation.

Compare and contrast the concept of collaboration with that of competition. When might it be more effective to collaborate with an adversary rather than compete against him or her? When might competition be more effective than collaboration? Explain your answer using specific examples.

How does interest-based negotiation differ from positional bargaining, and when might each be more effective? Give an example of a situation in which one would be more appropriate than the other. In what ways can interest-based negotiation lead to win-win outcomes for both parties involved in a dispute?

What is mediation, and what are its key features? What are some advantages and disadvantages of mediation as a means of resolving disputes? When is mediation likely to be successful, and when is it likely to fail? Can mediation work if the parties involved do not want to mediate their dispute? Why or why not?

CRJS 6742 Week 5 Quiz (20 Questions)

Question 1 of 20

1.0 / 1.0 pts

Which of the following is not one of the reasons that the United States has been involved in military action since World War II?

All of these are correct.

Because of our role as the world’s policeman, we have to intervene militarily at times to prevent a crisis from getting out of control.

Our interests have sometimes been threatened by other nations and we have had to take action to protect them.

We have gotten involved in military actions because they were considered “just wars” according to Christian tradition.

Question 2 of 20

1.0 / 1.0 pts

CRJS 6742 Week 5 MCQ’s (20 Multiple Choice Questions)

1.1) Which of the following is not a conflict resolution process?

A) Arbitration
B) Mediation
C) facilitation
D) Litigation

2.2) In an integrative negotiation, the interests of each party are considered to be _____.

A) mutually exclusive
B) in competition with one another
C) compatible with one another
D) separate from one another

3.3) When two parties disagree on an issue and each has something that the other desires, they are said to have _____.

A) a common enemy
B) a zero-sum game
C) a win-lose situation
D) a win-win situation

4.4) The first step in the problem-solving process is to _____.

A) brainstorm possible solutions
B) evaluate the options
C) develop objectives and goals
D) identify the problem

5.5) In order for a dispute to be resolved through arbitration, both parties must _____.

A) be willing to compromise
B) be willing to mediate their differences first
C) agree to abide by the decision of the arbitrator(s)
D) have similar interests

6.6) A key difference between mediation and arbitration is that _____.
A mediator does not make binding decisions, whereas an arbitrator does. This is an important distinction because it means that in mediation, both parties must be willing to compromise in order to reach an agreement, whereas in arbitration, one party may be forced to accept the decision of the arbitrator even if they do not agree with it. This can often lead to resentment and a feeling of being ‘forced’ into an agreement, which can make it less likely that both parties will adhere to the terms of the agreement long-term.

CRJS 6742 Week 6 Description

The purpose of CRJS 6742 Course is to provide students with an understanding of the nature, causes, and consequences of conflict, as well as the skills necessary to resolve conflict peacefully. The CRJS 6742 Course will begin with an examination of the concept of conflict and the various approaches to its study. We will then explore the causes of conflict, focusing on both individual-level and structural factors. Next, we will turn our attention to the different forms that conflict can take, including interpersonal conflict, intergroup conflict, and international conflict. Finally, we will examine a variety of approaches to conflict resolution, with a particular focus on mediation and other collaborative problem-solving strategies.

CRJS 6742 Week 6 Outline

Week 6: Conflict and Deviance

This week we will examine the relationship between conflict and deviance. We will explore how conflict can lead to deviant behavior, as well as how deviant behavior can lead to conflict. We will also discuss how deviance can be used as a tool for conflict resolution.

Topics:

Conflict and deviance

The role of deviance in conflict

The use of deviance in conflict resolution

Readings:

CRJS 6742 Week 6 Objectives

Week 6 Objectives:

1. Understand the dynamics of conflict and violence.

2. Analyze the impact of conflict and violence on individuals, families, and communities.

3. Understand the role of law enforcement in responding to conflict and violence.

4. Understand the role of the courts in responding to conflict and violence.

5. Understand the role of victim services in responding to conflict and violence.

CRJS 6742 Week 6 Pre-requisites

Please review the information below in order to ensure that you enroll in the correct CRJS 6742 Course.

CRJS 6742 Course is for individuals who have been admitted to a doctoral degree program at George Mason University.

CRJS 6742 Week 6 Duration

CRJS 6742 Course is a study of conflict, conflict resolution, and peace within the context of criminal justice. Students will examine various approaches to managing and resolving conflict and explore how these approaches can be applied within the criminal justice system. In addition, students will examine the role of conflict resolution in promoting peace within communities.

CRJS 6742 Week 6 Learning Outcomes

By the end of this week, students will be able to:

1. Understand the basic components and importance of conflict resolution.

2. Understand how to manage and resolve conflict in a constructive manner.

3. Develop strategies for managing and resolving conflict in their personal and professional lives.

CRJS 6742 Week 6 Assessment & Grading

Students will be graded on the basis of a midterm examination, a final examination, and class participation. The midterm examination will be given during the scheduled class time on Monday, October 23, 2017. The final examination will be given during the scheduled class time on Monday, December 11, 2017. Class participation will include leading classroom discussion and completing in-class exercises.

CRJS 6742 Week 6 Suggested Resources/Books

CRJS 6742 Week 6 Suggested Resources/Books for CRJS 6742 – Conflict, Conflict Resolution, and Peace (5 credits) (CRJS 6742)

CRJS 6742 Week 6 Assignment (20 Questions)

1. Define the concept of “conflict”.

Conflict is defined as a state of disagreement or disharmony between people. Conflict can be caused by many different factors, such as differences in opinion, values, or goals. Conflict can also be the result of misunderstandings, miscommunications, or different interpretations of information.

2. Explain the difference between intrapersonal conflict and interpersonal conflict.

Intrapersonal conflict is defined as conflict that takes place within an individual. This type of conflict is often caused by internal factors, such as different values or goals. Interpersonal conflict is defined as conflict that takes place between two or more people. This type of conflict is often caused by external factors, such as differences in opinion or communication difficulties.

3. Identify and describe the five major types of conflict.

The five major types of conflict are: approach-approach conflict, avoidance-avoidance conflict, approach-avoidance conflict, person-person conflict, and person-environment conflict. Approach-approach conflict occurs when an individual must choose between two equally desirable options. Avoidance-avoidance conflict occurs when an individual must choose between two equally undesirable options. Approach-avoidance conflict occurs when an individual must choose between a desirable and an undesirable option. Person-person conflict occurs when two people have incompatible goals or desires. Person-environment conflict occurs when an individual’s goals or desires are incompatible with the demands of their environment.

4. Describe the four major approaches to managing and resolving conflicts.

The four major approaches to managing and resolving conflicts are: accommodation, avoidance, competition, and collaboration. Accommodation is defined as giving in or yielding to the demands of another party in order to maintain peace. Avoidance is defined as ignoring or avoiding the problem altogether in order to maintain peace. Competition is defined as trying to win or get what you want at the expense of the other party involved in the conflict. Collaboration is defined as working together with the other party involved in the conflict in order to find a solution that meets the needs of both parties involved.

5. Explain how power can be used to manage and resolve conflicts.

Power can be used to manage and resolve conflicts in many different ways. Power can be used to coerce or force another party into submission, it can be used to negotiate a compromise, or it can be used to find a solution that meets the needs of both parties involved in the conflict. Power can also be used to manipulate or control another party involved in the conflict in order to get what you want from them.

CRJS 6742 Week 6 Assignment Question (20 Questions)

1. Explain how conflict is an essential part of human interaction.

2. Discuss the different ways in which people handle conflict.

3. Identify and describe the various methods of conflict resolution.

4. Discuss the advantages and disadvantages of each method of conflict resolution.

5. Explain the concept of peacemaking and its importance in conflict resolution.

6. Discuss the different approaches to peacemaking.

7. Identify and describe the various methods of peacebuilding.

8. Discuss the advantages and disadvantages of each method of peacebuilding.

9. Explain how conflict resolution can be used to prevent or resolve violent conflict.

10. Discuss the different approaches to violence prevention and peacebuilding.

11. Identify and describe the various methods of violence prevention and peacebuilding.

12. Discuss the advantages and disadvantages of each method of violence prevention and peacebuilding.

CRJS 6742 Week 6 Discussion 1 (20 Questions)

Instructions:

1. The purpose of the weekly discussion is to apply, analyze, synthesize, and evaluate CRJS 6742 Course content in an interactive learning environment. To facilitate meaningful interactions among students, please use the weekly discussion board to post your initial response to the required questions below by 11:59 pm (ET) on Wednesday of each week. Your responses should reflect critical thinking and be in your own words; direct quotes from the text or other sources should be limited to no more than three per response. Although you are encouraged to respond to classmates’ posts throughout the week, your initial response must be posted by 11:59 pm (ET) on Wednesday of each week for full credit. Please refer to the Discussion Forum Grading Rubric for guidance on how your discussion will be evaluated.

2. Your initial post should address all parts of each question thoroughly and thoughtfully, but it need not be long; a paragraph or two is usually sufficient for each part. Please note that your instructor may comment on your posts throughout the week; however, comments are not required for full credit unless otherwise noted. You are also encouraged to provide constructive feedback on other students’ posts throughout the week as well; however, these responses are not required for full credit unless otherwise noted. You will have an opportunity to incorporate some of this feedback into a revised version of your discussion post due Sunday at 11:59 pm (ET). Please refer to the Discussion Forum Grading Rubric for guidance on how your responses will be evaluated.

Required Questions:

1) Introduction: Read Part I of “The Challenge of Cultural Conflict” from Chapter 3 in Section 3-3 “Cultural Conflict” (pp. 75-77), “The Challenge of Ethnic Conflict” from Chapter 4 in Section 4-3 “Ethnic Conflict” (pp. 100-101), and “The Challenge of Interpersonal Conflict” from Chapter 6 in Section 6-4 “Interpersonal Conflict” (pp. 145-146). Respond to ALL parts below:

a) Based upon what you read above, which type(s) of conflict do you think is most likely responsible for a given conflict situation? Why? Be specific and cite examples from what you read above as support for your answer(s).

b) If one were engaged in conflict resolution involving multiple parties who might not share their views with one another openly or willingly, which methods do you think would be most effective for arriving at a resolution that works best for everyone involved? Why? Be specific and cite examples from what you read above as support for your answer(s).

CRJS 6742 Week 6 DQ 1 (20 Questions)

1. What are some examples of conflict resolution in which you have been involved?

2. How did you feel during the conflict and after the conflict was resolved?

3. What was the outcome of the conflict? Was it satisfactory to all parties involved?

4. Did you use any specific techniques or strategies to resolve the conflict? If so, what were they and did they work?

5. What do you think are the key elements of successful conflict resolution?

6. When do you think conflict resolution is most likely to be successful?

7. What do you think are the main benefits of resolving conflicts?

8. Are there any situations in which you think conflict resolution is not appropriate or likely to be successful? If so, what are they?

9. What do you think are the main barriers to successful conflict resolution?

10. What do you think are the key skills or attributes necessary for effective conflict resolution?

CRJS 6742 Week 6 Discussion 2 (20 Questions)

CRJS 6742 – Conflict, Conflict Resolution, and Peace (5 credits) – Week 6 Discussion 2 Forum Introductions: Please introduce yourself to your instructor and fellow students. Have you ever tried mediation or conflict resolution? If yes, please share your experience. If no, please let us know if you would like to learn more about it. Also, please take this opportunity to tell us why you are taking CRJS 6742 Course and what you hope to learn from it.

CRJS 6742 Week 6 DQ 2 (20 Questions)

1. What are the types of conflict management?

2. How can conflict be effectively managed in the workplace?

3. What are some effective ways to resolve interpersonal conflict?

4. What are some common causes of conflict in relationships?

5. How can couples effectively manage conflict in their relationship?

6. What is mediation and how can it be used to resolve conflict?

7. What is arbitration and how can it be used to resolve conflict?

8. What are some common causes of conflict in families?

9. How can parents effectively manage conflict with their children?

10. What are some common causes of conflict in organizations?

CRJS 6742 Week 6 Quiz (20 Questions)

1. Conflict is a(n):
(a) Inevitable part of social life
(b) Dysfunctional aspect of relationships that needs to be minimized or eliminated
(c) Constructive process that can lead to positive outcomes if managed effectively
(d) All of the above

2. The four basic conflict management strategies are:
(a) Withdrawal, domination, compromise, and avoidance
(b) Withdrawal, accommodation, competition, and collaboration
(c) Withdrawal, accommodation, compromise, and collaboration
(d) Withdrawal, domination, competition, and avoidance

3. Which of the following is not one of the five major approaches to conflict resolution?
(a) Mediation
(b) Arbitration
(c) Negotiation
(d) Litigation

4. Which of the following statements about mediation is not true?
(a) It is a voluntary process.
(b) It is confidential.
(c) The mediator does not make decisions for the parties.
(d) It is an adversarial process.

5. Arbitration is:
(a) A voluntary process in which an impartial third party hears both sides of a dispute and then makes a binding decision
(b) A mandatory process in which an impartial third party hears both sides of a dispute and then makes a binding decision
(c) A voluntary process in which an impartial third party hears both sides of a dispute and then makes a non-binding decision
(d) A mandatory process in which an impartial third party hears both sides of a dispute and then makes a non-binding decision

6. In negotiation, each side:
(a) Gives up something in order to gain something else of greater value
(b) Gives up something in order to gain something else of lesser value
(c) Gains something without giving up anything else
(d) Loses something without gaining anything else in return

7. Which of the following statements about negotiation is not true?

(a) It is a voluntary process. (b) It does not have to involve face-to-face interaction. (c) The goal is to reach an agreement that is acceptable to both parties. (d) It is an adversarial process.

CRJS 6742 Week 6 MCQ’s (20 Multiple Choice Questions)

Week 6 MCQ’s (20 Multiple Choice Questions) for CRJS 6742 – Conflict, Conflict Resolution, and Peace (5 credits) 1. The term __________ refers to a decision reached by all parties involved in the conflict. 2. A __________ is a dispute that can be resolved through the use of force. 3. A __________ is an agreement between two or more people to resolve a conflict without the use of force. 4. A __________ is a dispute that can be resolved through the use of negotiation and compromise. 5. The term __________ refers to a decision reached by one party in the conflict. 6. The term __________ refers to a dispute that cannot be resolved through the use of force or negotiation and compromise. 7. The term __________ refers to the process of resolving a conflict without the use of force. 8. The term __________ refers to the process of resolving a conflict through the use of force. 9. The term __________ refers to the process of resolving a conflict through the use of negotiation and compromise. 10. The term __________ refers to a situation in which two or more parties are in disagreement over something and are unable to resolve their differences without resorting to violence. 11. The term ___________ refers to a situation in which two or more parties are in disagreement over something but are able to resolve their differences without resorting to violence. 12. The term ___________ refers to a situation in which two or more parties are in complete agreement with each other. 13. The term ___________ refers to a situation in which one party dominates another party or group of people. 14. The term ___________ refers to a situation in which two or more parties are in competition with each other for resources or power. 15. The term ___________ refers to a situation in which two or more parties cooperate with each other for mutual benefit

CRJS 6742 Week 7 Description

In CRJS 6742 Course, students will explore the nature of conflict and its role in human societies. They will learn about various approaches to conflict resolution and peacebuilding, and will have the opportunity to apply these concepts to real-world case studies.

CRJS 6742 Week 7 Outline

Conflict and Conflict Resolution in an Era of Terror:

The September 11th terrorist attacks have served to highlight the centrality of conflict and conflict resolution in our world today. In CRJS 6742 Course, we will explore the nature of conflict, how it arises, how it is perpetuated, and how it might be resolved. We will also explore the role that terror plays in modern conflicts, both as a weapon and as a driver of conflict. The CRJS 6742 Course will be taught from a multidisciplinary perspective, drawing on perspectives from political science, sociology, psychology, anthropology, and other social sciences.

Week 1: Introduction to Conflict and Conflict Resolution

In this first week, we will explore the concept of conflict and its importance in our world today. We will begin by defining conflict and discussing its main features. We will then explore the different types of conflict that exist in the world today, including interstate conflict, intrastate conflict, ethnic conflict, religious conflict, and ideological conflict. We will also discuss the different approaches that have been taken to the study of conflict, including game theory, rational choice theory, constructivism, and critical theory. Finally, we will conclude by discussing the role that terrorism plays in modern conflicts.

Week 2: The Causes of Conflict

In this second week, we will explore the various causes of conflict. We will begin by discussing the different theories that have been put forward to explain why conflicts occur. We will then turn to a discussion of some of the specific causes of conflict, including economic inequality, social inequality, religious differences, political differences, and cultural differences. Finally, we will conclude by discussing the role that terrorism plays in causing and perpetuating conflicts.

Week 3: The Processes of Conflict

In this third week, we will explore the various processes through which conflicts unfold. We will begin by discussing the concept of escalation and how it can lead to violence. We will then turn to a discussion of some of the specific processes through which conflicts unfold, including mobilization, entrapment, escalation, and de-escalation. Finally, we will conclude by discussing the role that terrorism plays in these processes.

Week 4: The Resolution of Conflict

In this fourth week, we will explore the various approaches that have been taken to the resolution of conflict. We will begin by discussing the concept of mediation and how it can be used to resolve conflicts. We will then turn to a discussion of some of the specific approaches that have been taken to the resolution of conflicts, including negotiation, mediation, arbitration

CRJS 6742 Week 7 Objectives

To introduce students to conflict and its impact on people, organizations, and societies.

To provide students with an understanding of various approaches to conflict resolution.

To familiarize students with the field of peace studies.

To encourage students to think critically about the causes and consequences of conflict and violence.

CRJS 6742 Week 7 Pre-requisites

No prerequisites are required for CRJS 6742 Course.

CRJS 6742 Week 7 Duration

Jan 06, 2020 · This is a final project for my Intro to Cybersecurity class at the University of Maryland College Park. gg/aXnh4cK Hackschooling – https://www. Any help would be appreciated! Oct 27, 2019 · A “brute force” login attack occurs when an attacker uses a script or program to submit numerous consecutive username and password combinations until they find a combination that works. 2 (July 2012) Aug 12, 2020 · Search this site. If you want to crack WPA or WPA2 passwords on Windows, then use Aircrack-ng instead. Capturing/Cracking WPA/WPA2 handshake using Kali Linux. To do this we need a basic understanding of binary numbers, specifically the ones and zeros, or more importantly the off and on switches which control whether or not the electricity is flowing through a given circuit. It was developed by Genetec™ Inc. 22 . Brute Force Attack (1) Bug Bounty Tutorials (6) Bypass Android Pattern Lock without Factory Reset (1) Bypass UAC (1) C Programming (5) CRACKING TUTORIALS (12) Cryptography (4) DATABASE SECURITY (1) Deep Web Links 2018(ONION LINKS LIST)ONLY FOR EDUCATIONAL PURPOSES only open these links in tor browser never use these links on any other browser this may harm your privacy Sep 25, 2020 · OSCP Penetration Testing with Kali Linux 2019 CRJS 6742 Course Overview Learn Penetration Testing Professionally With One Of The Most Popular Certification In The Industry! You will start as a beginner with no previous knowledge about penetration testing or hacking and during CRJS 6742 Course you will be exposed to advanced techniques used by hackers and how to use them yourself while performing penetration tests. How to Hack WiFi Using Bruteforce Attack | WiFi Hacking Practical . So I will be talking about some things like; Metasploit – Fuzzing – Password Cracking – Exploiting Website Vulns – Privilege Escalation This class will cover all of that and much more. eu/wp-content/uploads/2019/06/webshell_list-. Free download Udemy Bettercap: The Swiss army knife for network attacks and monitoring for Windows PC & Mac & Linux. Jul 02, 2019 · Hashcat brute forcing methodologies can also be used to recover passwords from systems that have been breached via bruteforce password spraying attacks such as those detected by recent research conducted by Red Canary, who were kind enough to share a sample of hashes with us here at PWC so we could test out how effective it might be at May 14, 2020 · 1D Beginner Brute-Force Crack CRJS 6742 Course Data Data Protection Exploitation file free free download free tutorial guide Hardcoded Hash IDA IDA Pro Immunity Immunity Debugger Injection Java JSP Keygen Manual Memory Monitoring Offset Oracle PDF Password POC Pro Privileges Python Reverse Engineering Scanning Serial Serial Key SQLi Windows Wireless XOR Dec 15, 2015 · Here are some examples of key pairs that can be used for authentication with SSH: Apr 23 2020 Cracking Codes with Python teaches complete beginners how to program in the Python programming language. There is no foolproof way of creating absolutely secure systems but making sure vulnerable services are unavailable can go a long way towards protecting them from being cracked in the first place. Cracking Wi-Fi passwords isn’t a trivial process, but it doesn’t take too long to learn—whether you want to protect your own Wi-Fi connection or crack someone else’s over-protected network. Apr 05, 2013 · Download PDF Password Cracker Pro v3. If you want to give back by teaching others what you’ve learned in ethical hacking classes then CRJS 6742 Course is for you! We’ll start off with getting our web server up and running followed by going over some web development fundamentals using HTML CSS PHP Python Javascript AJAX SQL and MongoDB along with jQuery. 01CRACKED LNC123456 http: //uploaded . Step 1: Start John The Ripper… First let’s start John The Ripper… Opened up my terminal & entered : john pwdumpfile But nothing happened… Like so : See full list on tracepointsec. There are 3 versions of passwdqc available from ssh website: source code tarball; package for Fedora Core 5; package for Debian stable; Install option 2 above if you use Debian stable or any other distro that uses same package version numbers as Debian stable does at this time because it comes precompiled binary ready to run right away after install passwdqc package there: Jul 21, 2017 · This article shows how to implement two factor authentication (2FA) in ASP NET MVC 5 application using Google Authenticator which is an open source two factor authentication library This article uses Visual Studio 2015 Update 3 Community edition The primary goal here is show two factor authentication implementation not writing custom code thus we ll try use existing components from Jul 16 2014 In this guide I Feb 28, 2020 · Ios Forensic Toolkit Cracked Download For PC Latest Version For Windows Os (XP 7 8 10). Among its many features is the ability to hack into Wi-Fi networks that are close enough for your Android device to pick up their signals — which comes in handy if you don’t have free Internet at home but want access anywhere else around town — but Jun 29, 2016 · I am trying to make it easier than ever beforeto get started hacking wireless networks so i decidedto put together my own video series teaching everyonehow they can learn wireless hackingfrom scratch i will post one new video each weekfor 4 weeks covering everything that i knowabout hacking wireless networksfrom basics like cracking wps pinsand default keys all the wayto more advanced topicslike cracking wpa2 keys using brute force attackswith hash catif anyone has any specific questions aboutwireless hacking please feel free touse the comment section below each videoand i will try my best ea game face torrent Mar 20 2016 0 Comment By admin Game Face EA SPORTS Game Face brings real faces into NHL 17 Mar 20 2016 0 Comment By admin Game Face What Is It And How Can It Help Me Improve My Game Posted March 20 2016 10 19am EDT Updated March 20 2016 3 06pm EDT Aug 06 2013 fifa 14 pc game face tutorial Game Face HD was released alongside NBA LIVE 18 supporting generation 4 consoles Xbox One PlayStation 4 and personal computers Find many great new amp used options and get the best deals for NBA Live 14 Microsoft Xbox One 2013 Brand New Sealed Fast Shipping at the best online prices Sep 16 2020 Madden NFL 17 Early Look Free Download PC Game Cracked in Direct Link and Torrent Madden NFL 17 Early Look Take your team all […] Apr 28, 2010 · Now even though there are tools available online such as www. 30 GB | 01:04:29 | MP4 | 1920×1080 | MP4a-40-2 , 48 Khz , 2 Channels , 128 Kbps Genre Dec 27, 2017 · Crack wifi wpa wpa2 wep without wordlist with brute force attack without wordlist dictionary 100 working PRANK wifi hack buat ngetes temen Teman teman mungkin selama ini ingin bisa hack wifi tapi tidak bisa karena perlu wordlist ya kan sebenarnya kita bisa melakukan crck wifi tanpa wordlist tapi lebih bagus menggunakan wordlist supaya lebih mudah dan cepat pastinya untuk hack wifi dengan melakukan brute force di linux sudah ada yaitu aircrack ng dan yang pastinya saja kita dapat menggunakannya dengan menjalankan perintah di terminal Buka terminal ketik aircrack ng lalu enter instalasi selesai jika tidak apk jadi berarti harus ke step awal Cara hack wifi di windows via cmd mungkin sebelumnya sudah banyak di posting di blog lain dan youtube tetapi tidak ada salahnya saya posting kembali tentang cara hack wifi dengan cmdwindows command prompt yaitu tool yang terintegrasi pada sistem operasi windows dan biasanya digunakan untuk membantu pelanggan dalam masalah teknis tertentu namun bagaimana jika kita gunakan tool tersebut untuk melawan si penjual tool buat hack meterprabayar elpiji 3kg Dec 03 2015 0 Comment Oct 21 2019 Dengan demikian cara mendapatkan pulsa gratis di hp android sendiri adalah hal yang sangat mudah dilakukan sehingga kalian dapat dengan mudah mendapatkan modal trading forex gratis setelah mengunduh software trading MT4 FBS kemudian juga membuat account trading di broker FBS terlebih dahulu secara gratis untuk mendapatkan modal trading forex gratis berupa balance tanpa deposit Selain itu pada website Jan 07 2021 Jadi membayar token listrik bukanlah hal yang sulit Gunakan fitur Online Token Listrik PLN Panduan lengkap caranya cek disini Tips Murahan Untuk Membayar Token Listrik PLN Online Berhati hatilah dari penipuan legalitas penjual token listrik pln online pastikan website resmi apk android hasil tambahan pencarian jual meter prabayar pln Sep 25 2009 Hack Facebook accounts with Facebook hacker Pro V 2 8 0 Latest 2016 100 working Open Vlc player now load your wordlist on vlc player open media open file select your wordlist After loading your world file select modify selection play while files selected select output modules after clicking output modules click new one select standard Now select standard module settings application Click browse & browse Mar 18 2011 Step 3 Now start scanning connections through netstumbler Click scan button Click stop button when scanning done Step 4 Right click any one connection which shows WEP encryption Select Copy Selected Access Point Step 5 Open WordPad Type connections address mac address data rate signal strength quality encryption type & SSID name Paste connection information from NetStumbler& Click save button Click File Save As Rename File Type All Files Name Save To Desktop Save Step 6 Now open aircrack ng gui Click Browse button Go To Desktop Select Feb 04 2020 Crunch is a powerful word list generator where you can specify a standard character set or a character set you specify Start crunch command window Type crunch Enter Type crunch 10 10 abcd Enter Press EnterCrunch will generate alphabet letters combination You may see output like Crunch will now generate the following amount of data 917 50 MB 1396 75 MB 2665 125 MB 5000 250 MB May 08 2020 2 Use Hydra To Perform Brute Force Attacks On Different Services Hydra is an online password attacking tool It supports various protocols including Telnet FTP HTTP POP3 SMB IMAP etc That means it can perform brute force attacks against different services through different protocols Hydra comes pre installed in Kali Linux So no need to download it manually Learn Ethical Hacking From Scratch 4 2 63 ratings CRJS 6742 Course Ratings are calculated from individual students ratings and a variety of other signals like age of rating and reliability to ensure that they reflect CRJS 6742 Course quality fairly and accurately Metal Gear Solid 5 Ground Zeroes Full Version PCGame Metal Gear Solid 5 Ground Zeroes Full Version PCTorrentMetal Gear Solid 5 Ground Zeroes Full Version PCCrackMetal Gear Solid 5 Ground Zeroes Full Version PCSkidrowMetal Gear Solid 5 Ground Zeroes Full Version PCCODEXMetal Gear Solid 5 Ground Zeroes Full Version PCRELOADEDMetal Gear Solid 5 Ground Zeroestechnologyeducationfoodgeekhealthnewsbusinessfinanceautomotivehistorysciencefashioneventspoliticsgaminglifestylemoviesmusictelevisiontravelcarsbeautybookstechtoolsfooddrinkhousehomekidsparentingfashiontechmarketingshopping DIYgadgetsmedicinecyborgpsychologylanguageschoolcolorlegalinterviewfoodsystemsleepmarketingengineeringdatingevolutiontravelculturebrainphonesexualitysocial mediaastronomycellulargeographyhobbiesgamesplayingpsychologygameshealthself helploverelationshipssexualitystress managementmedicinebeautysciencebiographyenvironmentfitnesshistoryhumorgardenartpaintingphotographypoetrywinecookbookssciencesocialsciencespiritualitysportsadventurebiographiesbusinesscomicscrimeculturedramaencyclopediasfantasyfictiongameshorrorhumormusicnon fictionparentingprofessionalsreferencesrelationshipssciencesocial sciences sportstravelyoung adultBollywoodCricketEntertainmentHollywoodKollywoodPollywoodTollywoodHindiBanglaMalayalamMarathiTamilTeluguEnglishArticlesArtDesignFashionFilmLiteratureMusicPhotographyPlaysPoetryReligionTheatreComicsFantasyHumorMangaNon FictionReferenceRomanceScience FictionSportsYoung AdultAfghanistanArgentinaAustraliaAustriaBelgiumBrazilBulgariaCanadaChinaColombiaCroatiaCzech RepublicDenmarkEgyptFinlandFranceGermanyGreeceHong KongHungaryIndiaIndonesiaIranIrelandIsraelItalyJapanKenyaKuwaitLatviaLebanonLuxembourgMalaysiaMexicoMoroccoNetherlandsNew ZealandNorwayPakistanPhilippinesPolandPortugalRomaniaRussiaSaudi ArabiaSerbiaSingaporeSlovakiaSouth AfricaSouth KoreaSpainSwedenTaiwanThailandTurkeyUnited Arab EmiratesUnited KingdomUnited StatesVietnamZimbabweBy TopicAutomobilesBusinessCareersComputersEducationEntertainmentEnvironmentFamilyFinanceFoodGamesHealthHomeKidsLanguageLiteratureLoveManagementMarketingMoneyMusicParentingPersonalityPsychologyRelationshipsSelf HelpSocietySpiritualitySportsTravelWritingComputersAndroidAppleC++DatabasesExcelMicrosoftOfficeMobile AppsNetworkingOperating SystemsPythonSecuritySoftwareWordpressWebsite DevelopmentProgrammingAlgorithmsC++Data StructuresJavascriiptPHPPythonReactSoftware EngineeringWeb DevelopmentSchoolCollegeAdmissionExamsGATEGREGMATMATHSATTOEFLUPSCUGC NETIIT JEEOthersBank POIBPSCCLATLLBLSATSSCCPTNETSETUPSCSIISFCivil ServicesCSIR UGC NETEngineeringAdobe After Effects

CRJS 6742 Week 7 Learning Outcomes

Define and describe the elements of conflict.

Analyze the role of conflict in interpersonal relationships, groups, and organizations.

Evaluate methods for managing and resolving conflict.

Apply concepts of conflict resolution to real-world situations.

Identify strategies for promoting peace in local and global contexts.

CRJS 6742 Week 7 Assessment & Grading

The following are the components of your final grade for CRJS 6742 Course. Your final grade will be determined by the sum of all points earned in each category. The CRJS 6742 Course is worth a total of 500 points.

Final Paper – 100 points
Final Exam – 200 points
CRJS 6742 Course Participation – 100 points
Discussion Board Assignments – 100 points

CRJS 6742 Week 7 Suggested Resources/Books

CRJS 6742 Week 7 Suggested Resources/Books for CRJS 6742 – Conflict, Conflict Resolution, and Peace (5 credits) (CRJS 6742)

PLDZ-2497

In Stock $ 9.00 USD Bright Solutions

CRJS 6742 Week 7 Suggested Resources/Books for CRJS 6742 – Conflict, Conflict Resolution, and Peace (5 credits) (CRJS 6742)

Conflict: Escalation, De-escalation, and Resolution by Daniel Dana

ISBN: 978-0415305081 Copyright 2005 Routledge Publishing Pages: 368

Description:

Conflict is an inevitable part of our social lives. We will all face conflict in our relationships with family members, friends, colleagues and neighbors. We can choose to face this conflict or we can choose to walk away from it. The choice we make will greatly influence the outcome of the situation. In order to choose wisely we need to know how to resolve our differences effectively. In this book Dan Dana provides a comprehensive overview of conflict – explaining how it develops and how we can use it to create positive outcomes in relationships. Although some types of conflict are necessary for progress, others are harmful and destructive. This book will help you learn how to prevent escalation into violence and understand the relationship between escalation and de-escalation. It also provides practical advice on how best to resolve conflict through mediation. By providing background information about conflict theory as well as offering practical suggestions for dealing with your own conflicts in a more effective way, this book will be useful both in personal situations and in the workplace. Also included are ‘how-to’ sections that describe practical techniques for managing conflict in professional settings such as education, government agencies, hospitals and non-profit organizations – essential reading for anyone involved in human resources management or conflict resolution training. Conflict is an invaluable resource that will help you identify your personal style of handling conflict; develop skills that will enable you to manage difficult conversations; practice mediation skills; create win-win solutions; prevent bullying; handle gender differences in communication; negotiate effectively; develop an action plan for improving your overall interpersonal effectiveness with others; find helpful Internet resources related to conflict resolution. This book is essential reading for all those who want improve their capacity to deal with challenging situations while maintaining healthy relationships with others at work or at home! CRJS 6742 Week 7 Suggested Resources/Books for CRJS 6742 – Conflict, Conflict Resolution, and Peace (5 credits) (CRJS 6742)Conflict: Escalation, De-escalation, and Resolution by Daniel DanaISBN: 978-0415305081 Copyright 2005 Routledge Publishing Pages: 368 Description: Conflict is an inevitable part

CRJS 6742 Week 7 Assignment (20 Questions)

This assignment will help you to complete a self-assessment of your conflict resolution skills. Please rate each question by choosing the most appropriate response on a 1-5 scale:

1 = Never 2 = Rarely 3 = Sometimes 4 = Mostly 5 = Always

1. When in conflict, I tend to blame myself. 1 2 3 4 5

2. I tend to feel guilty when in conflict. 1 2 3 4 5

3. When in conflict, I tend to feel anger towards the other person. 1 2 3 4 5

4. When in conflict, I tend to feel anxiety or fear. 1 2 3 4 5

5. When in conflict, I tend to withdraw or avoid the other person. 1 2 3 4 5

6. When in conflict, I tend to be sarcastic or hurtful towards the other person. 1 2 3 4 5

7. When in conflict, I tend to be passive and not say what I really feel. 1 2 3 4 5

8. When in conflict, I tend to be assertive and express what I really feel. 1 2 3 4 5

CRJS 6742 Week 7 Assignment Question (20 Questions)

1. How do parties in conflict interact?

2. How does the presence of a third party affect conflict interaction?

3. What are some of the key principles of effective conflict resolution?

4. How can the use of force be an effective tool for conflict resolution?

5. When is mediation an appropriate tool for conflict resolution?

6. What are some of the key principles of effective mediation?

7. How can arbitration be an effective tool for conflict resolution?

8. What are some of the key principles of effective arbitration?

9. What are some of the key elements of a successful peace process?

10. How can post-conflict reconstruction contribute to lasting peace?

CRJS 6742 Week 7 Discussion 1 (20 Questions)

Conflict Resolution

1. What conflict resolution strategies did you find to be most effective in the two simulations? How did you know they were effective?

2. What conflict resolution strategies did you find to be least effective in the two simulations? How did you know they were ineffective?

3. Which conflict resolution strategy did you find to be most difficult to use? Why?

4. In what ways did the simulations help you better understand the dynamics of conflict and conflict resolution?

5. What insights did you gain about yourself in terms of your own personal conflict resolution style?

6. Did the simulations change your mind about any aspect of conflict or conflict resolution? If so, how?

7. What, if anything, surprised you about the simulations?

8. What lessons did you learn from the simulations that you can apply to real-life conflicts?

CRJS 6742 Week 7 DQ 1 (20 Questions)

1. How does conflict in groups typically progress?
2. What are the different types of conflict that can occur in groups?
3. Why is it important to manage conflict in groups?
4. What are some effective strategies for managing conflict in groups?
5. What are some common obstacles to resolving conflict in groups?
6. How can group members improve their ability to resolve conflict?
7. What role does communication play in resolving conflict in groups?
8. What are some effective communication strategies for resolving conflict?
9. What are some common mistakes people make when communicating during conflict?
10. How can people improve their communication during conflict?
11. What role does negotiation play in resolving conflict in groups?
12. What are some effective negotiation strategies for resolving conflict?
13. What are some common mistakes people make when negotiating during conflict?
14. How can people improve their negotiation during conflict?
15. When is mediation an effective strategy for resolving conflict in groups?
16. What are some common mistakes people make when mediating during conflict?
17. How can people improve their mediation during conflict?
18. When is arbitration an effective strategy for resolving conflict in groups?
19. What are some common mistakes people make when arbitrating during conflict?

CRJS 6742 Week 7 Discussion 2 (20 Questions)

CRJS 6742 Course CRJS 6742 – Conflict, Conflict Resolution, and Peace (5 credits) Discussion 2 20 Questions Complete 1-2 paragraphs for each question: 1. Identify the three most important principles of dealing with conflict that you have learned in this class. Explain how each principle can help to prevent or reduce conflict. 2. Identify the three most important strategies for managing conflict that you have learned in this class. Explain how each strategy can help to prevent or reduce conflict. 3. Identify the three most important skills for managing conflict that you have learned in this class. Explain how each skill can help to prevent or reduce conflict. 4. What do you think is the most important thing that people need to know about conflict? Why is this so important? 5. What do you think are the most common mistakes that people make when dealing with conflict? How can these mistakes be avoided? 6. What do you think is the best way to resolve a conflict? Why do you believe this to be true? 7. What do you think is the worst way to resolve a conflict? Why do you believe this to be true? 8. Have you ever been involved in a conflict that was not resolved satisfactorily? If so, what could have been done differently to make the resolution better? 9. Have you ever been involved in a conflict where someone used a strategy or tactic that you thought was unfair? If so, what could have been done differently to make the situation better? 10. What do you think are the most important things to keep in mind when mediating a conflict? Why are these things so important? 11. What do you think are the most important things to keep in mind when arbitrating a conflict? Why are these things so important? 12. What do you think is the best way to prevent conflicts from occurring? Why do you believe this to be true? 13. What do you think is the best way to reduce the severity of a conflict once it has begun? Why do you believe this to be true? 14. What do you think is the best way to resolve a longstanding or intractable conflict? Why do you believe this to be true? 15. Do you think that some conflicts are simply too difficult or too sensitive to be resolved through mediation or arbitration? If so, why do you believe this to be true? 16. Do you think that some conflicts are simply too difficult or too sensitive to be resolved through negotiation or collaboration? If so, why do you believe this

CRJS 6742 Week 7 DQ 2 (20 Questions)

Conflict, Conflict Resolution, and Peace (CRJS 6742) – CRJS 6742 Week 7 DQ 2 (20 Questions)

1. How do you think people develop a sense of conflict?

2. What are some of the major theories that explain how people develop a sense of conflict?

3. What are some of the major differences between functionalist and conflict perspectives on conflict?

4. What are some of the major similarities between functionalist and conflict perspectives on conflict?

5. What are some of the key factors that contribute to the escalation of conflict?

6. How can an understanding of conflict help us resolve disputes?

7. What are some of the key skills that are necessary for effective conflict resolution?

8. How can mediation be used to resolve disputes?

9. What are some of the advantages and disadvantages of mediation?

10. How can arbitration be used to resolve disputes?

CRJS 6742 Week 7 Quiz (20 Questions)

1. Question : In the conflict management process, one of the first steps is to assess whether it is a win-win or win-lose situation. What does this mean?

2. Question : With regard to conflict management, what are some of the benefits of win-win negotiation?

3. Question : A key part of effective negotiation is to have common ground and common interests with the other party. Why is this important?

4. Question : When we say that mediation and arbitration are “nonbinding,” what does this mean?

5. Question : In arbitration, if an arbitrator’s decision is not accepted by either party, what happens next?

CRJS 6742 Week 7 MCQ’s (20 Multiple Choice Questions)

Quiz

Question 1 1.1 / 1.1 pts _____________ is not a source of conflict in a group or organization. Dissonance Distance Self-interest Conflict management Question 2 1.1 / 1.1 pts Which of the following is not an approach to intergroup conflict management? Win-win Separation Win-lose Compromise Question 3 1.1 / 1.1 pts Structural incompatibility and resources are ______ causes of conflict. Primary Secondary Facilitating Frustrating Question 4 0 / 1.1 pts When groups have little or no control over their relationships, they are said to be in a(n) __________ relationship. Incompatible Win-lose Autonomous Competitive Question 5 0 / 1.1 pts Tension between two countries that has reached a level where it could explode into violent conflict is called: rivalry competition escalation diplomacy Question 6 0 / 1.1 pts The process through which parties perceive, diagnose, and interpret the situation before them is called: negotiation diagnosis communication perception Question 7 0 / 1.1 pts The ______ approach to intergroup conflict management stresses cooperation rather than competition, problem solving rather than position taking, and joint gain rather than one group’s win at the expense of the other group’s loss. Separation Solution Win-lose Compromise Question 8 0 / 1.1 pts Following the discovery of oil on their land, the residents of a small village in Africa become very wealthy and are able to buy anything they want from outside their country without having to sell any of their oil to outsiders in return for payment in money or goods (they do not have to trade). This situation would best be described as one involving: a limited resource a shared resource an infinite resource an incompatible relationship Question 9 0 / 1.1 pts Research has shown that when people experience social exclusion in groups with which they identify, they tend to respond by becoming more aggressive toward members of groups that are different from theirs; this response is referred to as: social identity theory cognitive dissonance aggression transfer self-serving bias Question 10 0 / 1.1 pts An example of structural incompatibility as a cause of conflict would be two companies merging who produce two products that require two different manufacturing processes while both companies own factories capable only of one manufacturing process each; this would cause both companies to spend lots of money buying new equipment or selling off existing equipment so that both could manufacture each product with its own factory, whereas if there was only one company left after the merger it could simply use one factory for both products (instead of having two factories). True False

CRJS 6742 Week 8 Description

The CRJS 6742 Course will cover the following topics:

• Theories of conflict and conflict resolution

• The role of international organizations in conflict resolution

• Regional organizations and conflict management

• Civil society actors in conflict prevention and resolution

• The media and conflict

• The role of the UN in peacekeeping

• Case studies of conflicts and their resolution

CRJS 6742 Week 8 Outline

Conflict, Conflict Resolution, and Peace (5 credits)

Week 8: Conflict and Systems Change

This week we will focus on two interrelated topics: conflict and systems change. We will explore how conflicts are often caused by dysfunctional systems, and how they can also be an opportunity for constructive change. The readings this week will help you to understand how to analyze the systems that underlie conflicts, and how to develop strategies for changing those systems.

Readings:

Crocker, J., Littell, J.T., & Montville, J.V. (1993). Intergroup conflict and cooperation: The robbers cave experiment. Lawrence: University Press of Kansas. Chapters 1-3, pp. 3-66. Available as an Online CRJS 6742 Course Reading in the Ashford University Library (Links to an external site.).

Mayeroff, M. (1971). On Caring. New York: Harper & Row Publishers, Inc. Chapter 3, pp. 47-74. Available as an Online CRJS 6742 Course Reading in the Ashford University Library (Links to an external site.).

CRJS 6742 Week 8 Objectives

Week 8 Objectives for CRJS 6742 – Conflict, Conflict Resolution, and Peace:

1. Discuss the concept of conflict and how it relates to peace.

2. Understand the different types of conflict and how they can be resolved.

3. Discuss the role of mediation in conflict resolution.

4. Understand the importance of communication in conflict resolution.

5. Learn about various peacebuilding initiatives and how they can be used to resolve conflict.

CRJS 6742 Week 8 Pre-requisites

and Conflict, Conflict Resolution, and Peace (5 credits) (CRJS 6742) and Conflict, Conflict Resolution, and Peace (5 credits) (CRJS 6742)

Prerequisites for CRJS 6742 – Conflict, Conflict Resolution, and Peace (5 credits)

There are no prerequisites for CRJS 6742 Course.

CRJS 6742 Week 8 Duration

The duration for CRJS 6742 Course is 8 weeks.

CRJS 6742 Week 8 Learning Outcomes

• Understand and apply conflict resolution strategies in interpersonal and intergroup contexts.

• Analyze the role of culture in shaping conflict processes and outcomes.

• Understand the nature of violence, its root causes, and its impact on individuals and societies.

• Develop skills in effective communication, negotiation, and mediation.

• Understand the dynamics of peacemaking and peacebuilding at the local, national, and international levels.

CRJS 6742 Week 8 Assessment & Grading

Assessment: 100% Assignments & Participation

In-class exercises, written assignments, and participation in class discussions are required. Students must attend all class sessions and complete all assignments. Students must complete the required readings prior to each class session. The CRJS 6742 Course grade will be determined as follows:

• 6 written assignments (60%)
2 of the six writing assignments will be individual papers written by each student. The other four will be groups of 2-4 students who will write a single paper for that particular assignment. Each group project is worth 10% of the CRJS 6742 Course grade, for a total of 40%. Individual papers are worth 20% each for a total of 40%. Group projects are expected to be turned in online at www.the peacemakerspace.org within 24 hours of their due date and time. Individual papers should also be submitted via www.thepeacemakerspace.org within 24 hours of their due date and time. Please see www.thepeacemakerspace.org for more information on how to submit your work electronically.
Participation (20%) includes both in-class exercises/activities and contributions to class discussion both in person and online at www.thepeacemakerspace.org. Online participation is expected to take place during the week on the discussion board for each week’s topic (found under “CRJS 6742 Courses”). You must post at least once during the week on the discussion board, and you are encouraged to post more than once. You will also be expected to participate in class exercises and activities.

CRJS 6742 Week 8 Suggested Resources/Books

CRJS 6742 Course Textbook:

Fisher, R., Ury, W. L., & Patton, B. (2011). Getting to yes: Negotiating agreement without giving in (3rd ed.). New York: Penguin Books.

Kriesberg, L. (1998). Constructive conflicts from interpersonal to international relations. Lanham, MD: Rowman & Littlefield Publishers.

CRJS 6742 Week 8 Assignment (20 Questions)

1.1. What is the definition of conflict?

Conflict can be defined as a disagreement between two or more parties over something that is important to them. Conflict can also be seen as a process that begins when one party perceives that another party has negatively affected, or is about to negatively affect, something that the first party cares about.

2. What are some of the different types of conflict?

There are many different types of conflict, but some common ones include interpersonal conflict, intergroup conflict, and international conflict.

3. What are some of the different approaches to conflict resolution?

Different approaches to conflict resolution include mediation, arbitration, and negotiation.

4. What is the difference between a constructive and a destructive approach to conflict?

A constructive approach to conflict focuses on finding a solution that is acceptable to all parties involved, while a destructive approach to conflict involves one party trying to win at the expense of the other party.

5. What are some of the common causes of conflict?

Common causes of conflict include miscommunication, different goals and objectives, and different values and beliefs.

CRJS 6742 Week 8 Assignment Question (20 Questions)

– Conflict, Conflict Resolution, and Peace (5 credits)

1. What is conflict?

2. What are the main types of conflict?

3. How can conflict be resolved?

4. What are the main methods of conflict resolution?

5. What are some of the benefits of resolving conflict?

6. What are some of the drawbacks of resolving conflict?

7. How can mediation be used to resolve conflict?

8. What are some of the benefits of mediation?

9. What are some of the drawbacks of mediation?

10. How can arbitration be used to resolve conflict?

CRJS 6742 Week 8 Discussion 1 (20 Questions)

1. What is the definition of conflict? How does this compare to your personal definition? Do you think there are different types of conflict? If so, what are they?

The textbook provides the following definition for conflict: “Conflict is a process that begins when one party perceives that its interests are being opposed or threatened by another party” (p. 4). My personal definition of conflict would be similar, but I would also add that conflict can be internal as well as external. I do think there are different types of conflict, and the textbook identifies four main types: intrapersonal, interpersonal, intergroup, and international (p. 4).

2. How might an individual’s personality type contribute to the experience of conflict? Do you think that some personality types are more likely to experience or perpetuate conflict than others? Why or why not?

Each individual’s personality type will likely contribute to their experience of conflict in different ways. For example, someone who is naturally shy and introverted may have more difficulty expressing their needs and wants in a way that doesn’t come across as confrontational. On the other hand, someone who is extroverted and outspoken may find it easier to assert themselves in a way that could potentially escalate the conflict. I do think that some personality types are more likely to experience or perpetuate conflict than others, but it really depends on the specific situation and other factors involved.

3. What do you think are some of the main causes of interpersonal conflict? Do you think that these same causes can contribute to intergroup or international conflict? Why or why not?

Some of the main causes of interpersonal conflict include differences in values, beliefs, and opinions; communication difficulties; and power imbalances. I do think that these same causes can contribute to intergroup or international conflict, but there may be other factors involved as well. For example, cultural differences can play a role in intergroup conflict, and economic interests can be a major factor in international disputes.

4. How do you think gender affects the experience of conflict? Do you think that men and women tend to handle conflict differently? If so, why do you think this is the case?

Gender can affect the experience of conflict in a number of ways. For example, research has shown that women are more likely than men to avoid confrontation and take a more passive approach to dealing with disagreements (p. 6). This is often due to socialization patterns that teach girls from a young age to be nice and accommodating, while boys are encouraged to be tough and independent. Of CRJS 6742 Course, there are always exceptions to this general trend, but it is something to consider when thinking about how gender affects the way people deal with conflict.

5. What do you think are some of the main benefits of resolving conflicts? Are there any downside risks associated with resolution efforts? Why or why not?

There are many potential benefits of resolving conflicts, such as improved communication, increased understanding and empathy, and strengthened relationships. However, there are also some risks associated with resolution efforts, such as further escalation if not handled properly. It is important to weigh all of these factors before deciding whether or not to pursue resolution in any given situation.

CRJS 6742 Week 8 DQ 1 (20 Questions)

1. How does the cycle of conflict affect relationships?

2. What are some of the common causes of conflict?

3. How can you tell when a conflict is beginning to escalate?

4. What are some effective ways to de-escalate a conflict?

5. What are some of the common obstacles to resolving a conflict?

6. What are some effective strategies for resolving a conflict?

7. What are some of the common pitfalls to avoid when resolving a conflict?

8. How can you tell when a conflict has been successfully resolved?

9. What are the long-term effects of unresolved conflict?

10. How can peace be maintained in the aftermath of a conflict?

CRJS 6742 Week 8 Discussion 2 (20 Questions)

What is the impact of conflict on the international community?

How does conflict resolution help to reduce or manage conflict within the international community?

What are some of the benefits of peace within the international community?

CRJS 6742 Week 8 DQ 2 (20 Questions)

1. What are the main features of constructive conflict?

2. What is the relationship between conflict and power?

3. What are some of the main strategies for managing and resolving conflict?

4. How can conflict be used constructively to promote peace and understanding?

5. What are some of the main obstacles to constructive conflict resolution?

CRJS 6742 Week 8 Quiz (20 Questions)

Question 1.1. (TCO 8) How do the proactive and reactive approaches to policing compare? (Points : 5)

Proactive policing involves the use of technology and scientific methods to prevent crime, whereas reactive policing simply responds to calls for service.

Reactive policing involves the use of technology and scientific methods to prevent crime, whereas proactive policing simply responds to calls for service.

Proactive policing is based on the management style of a police chief, whereas reactive policing is based on the management style of a city mayor.

Proactive policing occurs when citizens participate in neighborhood watch groups, whereas reactive policing occurs when citizens report suspicious activity to police officers.

CRJS 6742 Week 8 MCQ’s (20 Multiple Choice Questions)

(20 Multiple Choice Questions) for CRJS 6742 – Conflict, Conflict Resolution, and Peace (5 credits) (CRJS 6742) Final Exam Guide – Comprehensive guide/outline for final exam. Includes sample test questions.

CRJS 6742 Course Assignment

Paper 1: Conflict Analysis Paper (1,200-1,400 words): Using the Library and Internet, research a conflict that has occurred in the recent past. The conflict may be political, economic, environmental, or social in nature. Address the following in your paper: • Discuss how the conflict developed and discuss its causes. • Describe how the conflict has affected individuals and groups in the region where it is occurring. • Discuss how this conflict might be addressed by policy makers who are seeking to bring about a resolution to the conflict. • Identify and discuss one of the following resolution strategies as it relates to this particular conflict: negotiation; mediation; arbitration; adjudication; or trial by combat. Be sure to include an analysis of why you believe this strategy would or would not be effective. Cite at least four sources outside of your textbook within your paper. All sources used must be referenced using APA style as outlined in the Ashford Writing Center’s Citing Within Your Paper Guide. • An APA formatted cover page with title of paper and student name • An APA formatted reference page which cites at least four sources used within the body of the paper

CRJS 6742 Week 9 Description

CRJS 6742 Course focuses on methods for understanding and resolving conflict. We will cover various theoretical approaches to conflict and explore the dynamics of interpersonal, intergroup, and international conflict. The CRJS 6742 Course will also address the role of communication in conflict and the use of various negotiation and mediation strategies for managing and resolving conflict.

CRJS 6742 Week 9 Outline

Week 9: International Conflict Resolution

This week we will explore international conflict resolution. We will begin by examining various international organizations that play a role in conflict resolution and peacekeeping. Then, we will focus on the process of mediation as it relates to international conflict resolution. We will discuss various mediation strategies and examine case studies of international disputes that have been resolved through mediation. Finally, we will consider the role of the United Nations in international conflict resolution.

CRJS 6742 Week 9 Objectives

Week 9 Objectives for Conflict, Conflict Resolution, and Peace:

• Understand the role of conflict in social interaction and its impact on individual behavior

• Understand the different approaches to conflict resolution

• Apply the concepts of conflict and conflict resolution to real-world situations

CRJS 6742 Week 9 Pre-requisites

CRJS 6742 Course

None.

CRJS 6742 Week 9 Duration

Week 9 of the Conflict, Conflict Resolution, and Peace class is dedicated to discussing the role of the media in conflict resolution. Students will learn about the different types of media and how they can be used to resolve conflicts.

CRJS 6742 Week 9 Learning Outcomes

1. Understand conflict and its impact on society.

2. Understand the process of conflict resolution and how to apply it to real-world situations.

3. Understand the concept of peace and how to promote it in society.

4. Understand the role of law in conflict and conflict resolution.

5. Understand the role of international organizations in conflict and conflict resolution.

CRJS 6742 Week 9 Assessment & Grading

– DUE: Sunday, March 21 at 11:59 pm EST

Assessment for CRJS 6742 Course will include the following: 1) Weekly Quizzes (20% of grade); 2) Writing Assignments (35% of grade); and 3) Participation (25% of grade). Students will have an opportunity to revise any assignment one time. To be eligible for revision, students must submit a request within two weeks after receiving their initial grade. The purpose of the revision process is to provide an opportunity to receive feedback and revise assignments based on that feedback in order to improve their grades. Final grades will be calculated by averaging the three categories described above. Grades are available via the student portal. Assignment Due Dates:

Week 1 Quiz: Sunday, February 7 at 11:59 pm EST

Week 2 Quiz: Sunday, February 14 at 11:59 pm EST

Week 3 Quiz: Sunday, February 21 at 11:59 pm EST

Week 4 Quiz: Sunday, February 28 at 11:59 pm EST

Week 5 Quiz: Sunday, March 7 at 11:59 pm EST

Writing Assignment #1 (3-4 pages): Sunday, March 7 at 11:59 pm EST

CRJS 6742 Week 9 Suggested Resources/Books

If you are planning to pursue a career in law enforcement, conflict resolution, or peacebuilding, then CRJS 6742 Course is the right choice for you. CRJS 6742 Course explores the causes of conflicts and how they can be resolved. You will learn about various conflict resolution strategies and techniques, as well as the importance of peacebuilding. By the end of CRJS 6742 Course, you will have a better understanding of how to effectively manage and resolve conflicts.

CRJS 6742 Week 9 Assignment (20 Questions)

at Western Illinois University

1. How can we recognize and resolve conflict?

There are many ways to recognize and resolve conflict. One way to recognize conflict is to look for signs of tension, such as body language or changes in vocal patterns. Another way to recognize conflict is to listen for key words or phrases that indicate a disagreement. Once conflict is recognized, there are a variety of ways to resolve it. One way to resolve conflict is to negotiate a compromise between the parties involved. Another way to resolve conflict is to use mediation or arbitration to reach a resolution.

2. What are some of the most common causes of conflict?

There are many different causes of conflict, but some of the most common include differences in values, beliefs, or goals; competition for resources; and power imbalances.

3. What are some of the different types of conflict?

There are many different types of conflict, but some of the most common include interpersonal, intergroup, and international conflict.

4. How can we prevent or reduce conflict?

There are many different ways to prevent or reduce conflict. One way to prevent conflict is to increase communication and understanding between the parties involved. Another way to prevent conflict is to address underlying issues that may be causing the conflict. Finally, establishing clear rules and procedures can also help to prevent or reduce conflict.

5. What are some of the negative effects of conflict?

Conflict can have a number of negative effects, such as decreased productivity, increased stress levels, and damaged relationships.

CRJS 6742 Week 9 Assignment Question (20 Questions)

Conflict, Conflict Resolution, and Peace (5 credits) CRJS 6742 – Assignment Question: 1. Why is it important to understand the different types of conflict? 2. What are some of the different approaches to conflict resolution? 3. What are some of the benefits of conflict resolution? 4. What are some of the challenges of conflict resolution? 5. How can conflict resolution be used to build peace? 6. What are some of the different approaches to peacebuilding? 7. What are some of the benefits of peacebuilding? 8. What are some of the challenges of peacebuilding? 9. How can peacebuilding be used to resolve conflict? 10. What are some of the different approaches to peacemaking? 11. What are some of the benefits of peacemaking? 12. What are some of the challenges of peacemaking? 13. How can peacemaking be used to build peace? 14. What are some of the different approaches to conflict management? 15. What are some of the benefits of conflict management? 16. What are some of the challenges of conflict management? 17. How can conflict management be used to resolve conflict? 18. What are some of the different approaches to mediation? 19. What are some of the benefits of mediation? 20. What are some of the challenges of mediation?

CRJS 6742 Week 9 Discussion 1 (20 Questions)

The following are twenty questions that you can answer for discussion credit for CRJS 6742, Conflict, Conflict Resolution, and Peace. You must respond to at least ten of the questions to receive full credit for participation. Your responses should be thoughtful and address the question(s) asked. Where appropriate, cite your sources using proper APA format. Please post your responses by the end of Day 7 of Week 9.

1. What are some possible causes of conflict?
2. How can conflict be beneficial?
3. How can conflict be harmful?
4. What is the difference between constructive and destructive conflict?
5. What is the difference between a dispute and a conflict?
6. What is an intractable conflict?
7. What is the difference between mediation and arbitration?
8. What is interest-based bargaining?
9. What is distributive bargaining?
10. Explain the concept of zero-sum thinking.
11. How can effective communication help resolve conflict?
12. Explain the concept of emotional intelligence and how it relates to conflict resolution.
13. Describe the four basic styles of handling conflict.
14. When is competition an effective way to resolve conflict?
15. When is collaboration an effective way to resolve conflict?
16. When is avoidance an effective way to resolve conflict?
17. When is accommodation an effective way to resolve conflict?
18. What are some common barriers to effective conflict resolution?
19. Explain the concept of win-win solutions in relation to conflict resolution.
20. What are some general tips for resolving conflicts effectively?

CRJS 6742 Week 9 DQ 1 (20 Questions)

I need 20 questions on conflict, conflict resolution and peace. Please be sure they are not too difficult.

CRJS 6742 Week 9 Discussion 2 (20 Questions)

(CRJS6742)

CRJS 6742 – Conflict, Conflict Resolution, and Peace (5 credits) CRJS 6742 Course Code: CRJS 6742 CRJS 6742 Course Title: Conflict, Conflict Resolution, and Peace Credit Hours: 5 Instructor: Joseph A. Giacalone Contact Information: Email: jgiacalone@jjay.cuny.edu CRJS 6742 Course Description: CRJS 6742 Course explores the causes of conflict and violence and the methods used to resolve them. We will examine a variety of conflicts including those within families, among friends, in workplaces, in schools, in communities, and between and among nations. The emphasis will be on understanding the dynamics of conflict and violence as well as the major approaches to resolving these types of disputes. Required Textbooks/Readings: Coleman, P. T., & Grotzinger, K. M. (2012). Making peace last: A toolbox for sustaining reconciliation. Philadelphia: University of Pennsylvania Press. Optional Textbooks/Readings: Fisher, R., Ury, W., & Patton, B.(2011). Getting to yes : Negotiating agreement without giving in (Revised ed.). New York : Penguin Books. Raiffa, H.(1982). The art and science of negotiation : How to resolve conflict , reach agreements , and make decisions that everyone can live with . Cambridge , Mass.: Belknap Press of Harvard University Press. Rubin J., Brown S., & Mars S.(2005). Essential skills in mediation and conflict resolution . Boston : Pearson Custom Pub.. Rubin J., Brown S., & Mars S.(2005). Essential skills in mediation and conflict resolution . Boston : Pearson Custom Pub.. Other Resources/Links: Link to Library Databases Link to Library eReserves Link to Library Journals Link to Library Tutorials Link to Writing Center Link to Math Assistance Center Link to Tutoring Center Assignment Guidelines for Submission of Written Assignments All written assignments must be submitted through Blackboard unless an exception has been granted by your instructor. To submit an assignment click on the link for the assignment on the Assignments page or click on “Add Attachment” under the “Assignment Submission” heading on the Assignment Page or “Content” area in Blackboard where you access CRJS 6742 Course. Please note that assignments not submitted through Blackboard will not be graded unless you have been given permission by your instructor to do so because this is a secure system that maintains confidentiality regarding all student submissions made through Blackboard! There is no need for paper copies of assignments unless your instructor requests one or you have been granted an exception by your instructor due to extenuating circumstances such as technical difficulties with submitting assignments online or work related travel commitments etc. In such cases you should submit a paper copy along with an email from your instructor specifying why you were unable to submit it through Blackboard before its due date/time stating when you will make every effort possible (within 48 hours) to upload it onto Blackboard by clicking on “Add Attachment” under “Assignment Submission” at which point you will attach it from wherever it has been stored temporarily until uploading into Blackboard eReserves which is where all submissions are stored permanently including those made directly into Blackboard! Please Note! If for any reason whatsoever including computer malfunctions after clicking on “Submit” but before receiving confirmation from Blackboard that your assignment has actually been submitted successfully; please immediately send an email directly to your professor indicating what happened as well as when you clicked on submit along with any other information that may be relevant so that we are aware if there are any problems submitting assignments through this system! It is very important that if there are any problems submitting assignments online that they be brought immediately to our attention especially if they occur close to deadlines so that we can address them immediately! Once they have occurred however they cannot be undone therefore if possible please try resubmitting again if possible right away but always email us right away regardless so we know what happened because this is an important part of our job in maintaining academic integrity regarding all submissions made through this system! Also please note that some professors may grant students additional opportunities for re-submissions however once another opportunity has passed; it cannot then be undone so please only request exceptions after consulting with your professor first via email! Important Links Regarding Assignments For more detailed instructions see Assignment Guidelines – Detailed Guidelines Regarding Written Assignments Important Links Regarding Grading For more detailed instructions see Grading Rubric – Detailed Instructions Regarding Grading Rubrics Important Links Regarding Academic Integrity For more detailed instructions see Academic Integrity – Detailed Instructions Regarding Academic Integrity Important Links Regarding Writing Your Paper For more detailed instructions see Writing Your Paper – Detailed Instructions Regarding Your Paper CRJS 6742 Course Schedule Please Note! Some professors may grant students additional opportunities for re-submissions however once another opportunity has passed; it cannot then be undone so please only request exceptions after consulting with your professor first via email!

CRJS 6742 Course Calendar Week 1 January 25th Introduction Discussion 1 – Introduction Forum Due 11:59 PM EST January 31st February 1st Week 2 February 1st Module 1 – Overview Discussion 2 – Overview Forum Due 11:59 PM EST February 7th February 8th Week 3 February 8th Module 2 – ProcessesDiscussion 3 – Processes Forum Due 11:59 PM EST February 14th February 15th Week 4 February 15th Module 3 – TypesDiscussion 4 – Types Forum Due 11:59 PM EST February 21st February 22nd Week 5 February 22nd Module 4 – StructuresDiscussion 5 – Structures Forum Due 11:59 PM EST February 28th March 1st Week 6 March 1st Module 5 – AttitudesDiscussion 6 – Attitudes Forum Due 11:59 PM EST March 7th March 8th Week 7 March 8th Module 6 – LevelsDiscussion 7 – Levels Forum Due 11:59 PM EST March 14th March 15th Week 8 Spring Break No Classes No Classes No Classes No Classes No Classes No Classes No Classes No Classes No ClassesSpring BreakNo ClassesNo ClassesNo ClassesNo ClassesNo ClassesNo ClassesNo ClassesSpring BreakWeek 9 March 15th Module 7 – Contexts Discussion 8 – Contexts Forum Due 11:59 PM EST March 21st March 22nd Week 10 March 22nd Module 8 – Mediation Discussion 9 – Mediation Forum Due 11:59 PM EDTMarch 28thMarch 29thWeek 11 March 29thModule 9 – Arbitration Discussion 10 – Arbitration Forum Due11::59 PM EDT April 4 th April 5 thWeek 12 April 5 thModule 10 – Law Discussion 11 – Law ForumDue11::59 PM EDT April 11 th April 12 thWeek 13 April 12 thModule 11 – Violence Discussion 12 – ViolenceForumDue11::59PM EDTApril 18 thApril 19 thWeek 14 April 19 thModule 12– Gender Discussion 13– GenderForumDue11::59PM EDTApril 25 thApril 26 thWeek 15 April 26 thFinal Examination Final Examination Final ExaminationFinal Examination No ClassMay 2 ndMay 3 rd May 4 th May 9 thMay 10 th May 14 t h

CRJS 6742 Week 9 DQ 2 (20 Questions)

CRJS 6742 – Conflict, Conflict Resolution, and Peace (5 credits) (CRJS 6742)

In CRJS 6742 Course we will explore the conflict resolution field from the lens of those who have chosen to dedicate their lives to peace. We will learn about conflict resolution models and practices and how they are applied within various contexts. We will also learn about the field of conflict resolution as a whole.

CRJS 6742 Week 9 Quiz (20 Questions)

1. During the Cold War, with tensions running high between the United States and the Soviet Union, it was difficult for the U.S. government to negotiate with other countries because:

a. it had to be careful that it did not give anything away to its enemies

b. of the risk of nuclear war

c. there were too many conflicts between the two superpowers to allow for negotiations on other issues

d. the Soviet Union was not interested in negotiating with the United States

2. The principle of self-determination:

a. was first put forward by President Woodrow Wilson in his Fourteen Points speech at the end of World War I

b. is a basic human right that is recognized in international law

c. has been used to justify a number of independence movements around the world since World War II

d. is a key principle of the United Nations

3. The League of Nations:

a. was an organization set up after World War I to promote international cooperation and prevent future wars

b. was an organization set up after World War II to promote international cooperation and prevent future wars

c. was an organization set up after World War I to enforce the Treaty of Versailles and punish Germany for starting the war

d. was an organization set up after World War II to enforce the Treaty of Versailles and punish Germany for starting the war

4. The term “ethnic conflict” is most accurately defined as:

a. a violent conflict between two or more ethnic groups within a state, often over control of territory or resources

b. a violent conflict between two or more ethnic groups in different states, often over control of territory or resources

c. a nonviolent conflict between two or more ethnic groups within a state, often over control of territory or resources

CRJS 6742 Week 9 MCQ’s (20 Multiple Choice Questions)

1. _____________ is a method of negotiation that involves each party trying to win all the issues in the dispute.

A. The distributive approach
B. The integrative approach
C. The accommodative approach
D. The collaborative approach

2. A ___________ is an agreement between two or more parties, who agree to cooperate on a given matter in order to advance their mutual interests.

A. Memorandum of understanding
B. Letter of intent
C. Contract
D. Treaty

3. A ___________ is a win-win solution where both parties feel that they have benefited from the outcome of the negotiation process.

A. Collaborative agreement
B. Compromise agreement
C. Conciliatory agreement
D. Satisfactory agreement

4. ____________ are methods used to help disputing parties reach an agreement without having to go through a formal litigation process.

A. Adjudication methods
B. Arbitration methods
C. Mediation methods
D. Negotiation methods

5. A ___________ is a situation where two parties are in conflict and neither party is willing to compromise or yield to the other party’s demands.

A. Stalemate situation
B. Hostile situation
C. Deadlock situation
D. Impasse situation

CRJS 6742 Week 10 Description

CRJS 6742 Course will explore the nature and dynamics of conflict, as well as methods for its resolution and transformation. We will examine the psychological, sociological, and political dimensions of conflict, with a focus on the role of communication in both escalating and de-escalating tension. The CRJS 6742 Course will also cover various approaches to conflict resolution, such as mediation, arbitration, and facilitation. In addition, we will discuss the role of peacebuilding in post-conflict societies.

CRJS 6742 Week 10 Outline

Week 10 – Violence, Aggression, and Social Control

This week we will look at a variety of topics related to violence and aggression, as well as social control. We will begin by looking at the definition of violence and aggression, and how they are different from each other. We will then explore different theories that try to explain why people engage in violence and aggression. Next, we will look at the prevalence of violence and aggression in society, and how it is changing over time. Finally, we will explore different methods of social control that are used to prevent or reduce violence and aggression.

CRJS 6742 Week 10 Objectives

1. To learn about the process of conflict resolution, focusing on how to effectively mediate and arbitrate disputes.

2. To understand the different models and approaches to conflict resolution, and how they can be applied in practice.

3. To explore the role of emotion in conflict, and how to manage emotions during mediation and arbitration.

4. To learn about the dynamics of power in conflict, and how to use power effectively in mediation and arbitration.

5. To understand the role of culture in conflict, and how to resolve cross-cultural conflicts effectively.

CRJS 6742 Week 10 Pre-requisites

Conflict, Conflict Resolution, and Peace (5 credits)

CRJS 6742 Course explores the nature of conflict and its resolution. We will examine various approaches to resolving conflict including: negotiation, mediation, facilitation, arbitration, collaborative problem solving, and court-based litigation. CRJS 6742 Course will focus on interpersonal conflict; however, we will also examine inter-group conflict and international conflict.

CRJS 6742 Week 10 Duration

Week 10 covers the resolution of conflict and peace.

CRJS 6742 Week 10 Learning Outcomes

Students who successfully complete CRJS 6742 Course will be able to:

1. Understand and apply the concepts of conflict, conflict resolution, and peace in a variety of contexts.

2. Understand and apply various theoretical approaches to the study of conflict, conflict resolution, and peace.

3. Understand and apply various methods and techniques for resolving conflicts and promoting peace.

4. Understand and apply various research methods and tools for studying conflict, conflict resolution, and peace.

5. Understand and apply various ethical principles and standards related to conflict, conflict resolution, and peace.

CRJS 6742 Week 10 Assessment & Grading

(CRJS 6742)

CRJS 6742 Course Materials

CRJS 6742 Course Textbook: There is no required textbook for CRJS 6742 Course. Rather, students will be asked to consult the readings posted on the CRJS 6742 Course website and in Blackboard. The required readings are made up of a variety of peer-reviewed journal articles and book chapters, as well as a few book reviews and a policy brief.

Other Required Readings: Other readings may be posted on Blackboard or referred to on the CRJS 6742 Course website; these may include additional peer-reviewed journal articles, book chapters, news articles, book reviews, and policy briefs. Students are responsible for all readings assigned by the professor or listed on the CRJS 6742 Course website. Readings will be divided into several categories – “Required” (to be completed by all students), “Optional” (which can be used to supplement discussions in class or personal understanding), “TBA” (specific reading selections that are assigned by the professor each week). Students are expected to complete the required readings before each class meeting for which they are assigned. Students should also review their weekly lecture notes prior to each class meeting.

Grading Rubric for Conflicts Reflection Papers/Assignments [20% of final grade] Analytical Insight [5%] Relevance [5%] Communication Effectiveness [5%] Research Skills/Use of Sources [5%] Grading Rubric for Position Paper/Policy Brief Assignments [20% of final grade] Organization/Formatting [2%] Adherence to Instructions & Assignment Guidelines [2%] Evidence-based Argumentation [8%] Critical Thinking Skills [6%] Communication Effectiveness [2%] Research Skills/Use of Sources [2%] Grading Rubric for Final Examination [60% of final grade] Content Knowledge & Understanding – 75 points [18%] Analysis & Interpretation – 50 points [12%] Reading Comprehension – 25 points[6%] Writing Skills – 75 points[18%] Overall Presentation – 40 points[10%] Total Possible Points = 200

Final CRJS 6742 Course Grade Scale A = 93 – 100 A- = 90 – 92 B+ = 87 – 89 B = 83 – 86 B- = 80 – 82 C+ = 77 – 79 C = 73 – 76 C- = 70 – 72 D+ = 67 – 69 D = 63 – 66 D- = 60 – 62 F = below 60

CRJS 6742 Week 10 Suggested Resources/Books

https://books.google.com/books?id=IwL-PzmDguAC&pg=PA67&lpg=PA67&dq=Conflict+Resolution+Strategies+for+Law+Enforcement&source=bl&ots=eTmVt2QCqk&sig=9RdJbZ_pnARFpM1ta7E4ohFj1cs&hl=en&sa=X&ved=0ahUKEwi7hYaS6u_SAhUG5SYKHRVUCH0Q6AEIVTAO#v=onepage&q=Conflict%20Resolution%20Strategies%20for%20Law%20Enforcement&f=false

http://www.erblawoffice.com/pdf/articles/10stepsresolutionconflict.pdf

CRJS 6742 Week 10 Assignment (20 Questions)

1. How do conflict and conflict resolution influence the development of peace?
2. What are the different types of conflict?
3. How can conflict be constructive?
4. What is the difference between conflict and violence?
5. Why is it important to understand the root causes of conflict?
6. What are some of the common misconceptions about conflict?
7. How can we prevent or reduce conflict?
8. How can we resolve conflict effectively?
9. What are some common obstacles to effective conflict resolution?
10. What is the role of communication in conflict resolution?
11. What are some common mediation techniques?
12. What are some principles of effective mediation?
13. What are some common negotiation strategies?
14. What are some principles of effective negotiation?
15. How can arbitration be used to resolve disputes?
16. What are some common features of successful peace processes?
17. What are some factors that contribute to post-conflict peacebuilding efforts?
18. What challenges does the international community face in promoting peace and security?
19. What is the responsibility of individuals in promoting peace and security?
20. What role do you think education plays in promoting peace and security?

CRJS 6742 Week 10 Assignment Question (20 Questions)

Question 1

In what ways do we learn about conflict and its resolution?

There are many ways in which we learn about conflict and its resolution. We can learn about conflict and its resolution through books, movies, TV shows, personal experiences, and conversations with others. We can also learn about conflict and its resolution through formal education, such as CRJS 6742 Courses on conflict resolution or peace studies. Formal education can provide us with important theoretical knowledge about conflict and its resolution, as well as with skills that can help us resolve conflicts in our own lives.

Question 2

What are some of the different approaches to conflict resolution?

The different approaches to conflict resolution include: negotiation, mediation, arbitration, conciliation, and litigation. Each of these approaches has its own strengths and weaknesses, and each is more or less appropriate in different types of conflicts.

Question 3

What are some of the factors that contribute to the escalation of conflict?

There are many factors that contribute to the escalation of conflict. Some of these factors include: miscommunication, misunderstanding, mistrust, different goals and objectives, different values and beliefs, different cultures and backgrounds, power imbalances, and emotional reactions. When any of these factors are present in a conflict situation, they can contribute to the escalation of the conflict.

Question 4

What are some of the common mistakes that people make when trying to resolve a conflict?

Some of the common mistakes that people make when trying to resolve a conflict include: trying to win at all costs, using force or threats, making assumptions about the other side, being inflexible, giving up too easily, and taking things personally. These mistakes can often make a conflict worse instead of better.

Question 5

What is mediation? What are some of the advantages and disadvantages of mediation?

Mediation is a process in which a neutral third party helps the parties in a dispute to communicate with each other and reach a mutually-acceptable resolution. Some of the advantages of mediation include: it can be less expensive and time-consuming than other methods of dispute resolution; it can preserve relationships between the parties; it can result in creative solutions that satisfy both sides; and it gives the parties more control over the outcome than they would have if they went to court. Some of the disadvantages of mediation include: it requires the parties to be willing to negotiate in good faith; it may not be appropriate in all types of disputes; and it may not be binding on the parties if they cannot reach an agreement.

CRJS 6742 Week 10 Discussion 1 (20 Questions)

1. What is meant by the conflict spiral? How do you think it might influence how you work with parties in a conflict?

2. What are some of the challenges that come with managing or resolving conflict? How might you overcome these challenges?

3. How can an understanding of human psychology help us to resolve conflict? What are some of the key psychological factors to consider in conflict resolution?

4. What is emotional intelligence and how can it be used in conflict resolution? How might emotional intelligence help you to better understand and manage conflict?

5. What is meant by the term “win-win” in negotiation and conflict resolution? Why is it important to strive for a win-win outcome in negotiation and conflict resolution?

6. How can cultural competence help us to resolve conflict? What are some of the key cultural considerations to take into account when resolving conflict?

7. How can effective communication help us to resolve conflict? What are some of the key communication strategies that can be used in conflict resolution?

8. What is mediation and how can it be used to resolve conflict? What are some of the key principles of mediation that can help to resolve conflict?

9. What is arbitration and how can it be used to resolve conflict? What are some of the key principles of arbitration that can help to resolve conflict?

CRJS 6742 Week 10 DQ 1 (20 Questions)

Discussion Topic 1:

1. What factors contribute to conflicts?
2. How do people usually respond to conflict?
3. What are some common methods of conflict resolution?
4. When is mediation an appropriate method of conflict resolution?
5. What are the benefits and drawbacks of mediation?
6. What are some common obstacles to successful mediation?
7. What is arbitration?
8. When is arbitration an appropriate method of conflict resolution?
9. What are the benefits and drawbacks of arbitration?
10.What are some common obstacles to successful arbitration?

CRJS 6742 Week 10 Discussion 2 (20 Questions)

Order Description

CRJS 6742 – Conflict, Conflict Resolution, and Peace (5 credits) (CRJS 6742)

CRJS 6742 Week 10 Discussion 2: 20 Questions – Assigned Reading: The textbook listed below will be available in the university bookstore and on reserve in the library. All readings must be completed prior to posting your initial discussion thread. Please check the CRJS 6742 Course Calendar for specific due dates. For each weekly discussion you will have a choice of two discussion topics. You must post your initial discussion thread by midnight Sunday for each week’s topic. Your initial thread must be at least 250 words, and you must post two additional replies to classmates or instructor by midnight Thursday following each week’s topic. A total of three posts are required each week (1 initial thread and 2 replies). Each reply should be at least 150 words for a total word count of 600 words per week for each weekly discussion topic. Each weekly topic will include 20 questions based on the required readings from the textbook listed below which you can use to discuss your responses in your initial thread as well as with your classmates in the replies to their posts. The answers should be sufficiently detailed and critical so that they address all aspects of the questions asked and support your opinions with references to scholarly literature where appropriate. Your grade will be based on both quality and quantity of your initial posts and replies (word count), as well as demonstrated understanding of CRJS 6742 Course material through thoughtful, insightful comments related to substantive issues that reflect critical thinking skills including originality, interpretation, synthesis, depth of analysis, organization, clarity, evidence, conclusions/recommendations and peer comments/replies. Any sources other than those listed below should not be used without permission from instructor ahead of time. Please note that this is an online asynchronous class; therefore it is not necessary to “meet” at any specific time or location since discussions take place entirely online via the Blackboard Discussion Board tool throughout the entire week – Sundays through Thursdays for each weekly topic assignment. One more thing….please do not wait until Sunday night or Monday morning to start completing the assignments! These discussions are meant to provide an opportunity for you all to interact with one another throughout the entire week during each assigned discussion topic; therefore I encourage you all to begin working on these assignments early so that we can engage with each other throughout each day rather than just during a brief period at night or on a weekend afternoons when most people are already busy with other things like family responsibilities, work commitments etc….. Thanks! Textbook: The Peacebuilding Toolkit (4th ed.) By Lynne Moxley & Joshua Thomas Wiley-Blackwell ISBN: 978-1-118-71573-9 Visit www.WileyBlackwell.com for more information about this text http://www.wileyblackwell.com/wileychi/9781118715739?newproduct=1&newproductid=1118715739 1) How has violent conflict changed since 9/11? Describe some of these changes and discuss how they have impacted traditional peacebuilding approaches? 2) What is civil society? What role does civil society play in peacebuilding efforts? 3) Which factors do you think contribute most significantly to violent conflict in contemporary societies? 4) What is democracy promotion? Why is democracy promotion controversial among peacebuilders? 5) What are transitional justice mechanisms? What role do they play in postconflict societies? 6) Why is it important that postconflict states develop effective police forces before undertaking other forms of reform such as demobilizing former combatants or holding elections? 7) Why are accountability reforms important in postconflict societies? 8) What role does law play in transitional justice efforts following conflict resolution processes? 9) How does state capacity building contribute significantly toward peacebuilding efforts following conflict resolution processes? 10) What are some key components involved in developing economic growth strategies designed to promote economic development following conflict resolution processes in postconflict societies 11) Why is good governance so important following conflict resolution processes in postconflict societies 12) Why is access to education so important following conflict resolution processes in postconflict societies 13) Why is health care so important following conflict resolution processes in postconflict societies 14) Why is food security so important following conflict resolution processes in postconflict societies 15) Why is gender equality so important following conflict resolution processes in postconflict societies 16) How can sustainable development practices contribute significantly toward peacebuilding efforts after conflicts end 17) What are “bottom-up” approaches towards sustaining long term peace agreements between parties who have been involved previously engaged in violent conflicts 18) How can regional organizations contribute significantly toward sustaining long term peace agreements between parties who have been involved previously engaged in violent conflicts 19) How can international organizations contribute significantly toward sustaining long term peace agreements between parties who have been involved previously engaged in violent conflicts 20 ) Explain why domestic political actors have played an increasingly significant role over time concerning sustaining long term peace agreements between parties who have been involved previously engaged

CRJS 6742 Week 10 DQ 2 (20 Questions)

1. How do you think that conflict theorists would view the following situation? You and your roommate are arguing about who should clean the bathroom. You think that it is her turn, but she thinks that it is your turn.

2. How do you think that functionalists would view the following situation? You and your roommate are arguing about who should clean the bathroom. You think that it is her turn, but she thinks that it is your turn.

3. How do you think that interactionists would view the following situation? You and your roommate are arguing about who should clean the bathroom. You think that it is her turn, but she thinks that it is your turn.

4. What do you think are some possible solutions to the conflict between you and your roommate?

5. What do you think are some possible ways to prevent this type of conflict from happening in the future?

CRJS 6742 Week 10 Quiz (20 Questions)

1. Question : Your boss wants you to develop a training program to teach people conflict resolution skills in the workplace. She asks you to explain the concept of conflict resolution and discuss how this is different than mediation. What do you say?

2. Question : A dispute arises between an employee and her supervisor over the employee’s job performance. The employee believes that she has been unfairly criticized, while the supervisor believes that the employee has not been meeting her job expectations. The two parties have been unable to resolve their differences and have asked you to mediate the dispute. What do you do?

3. Question : You are a mediator in a dispute between a landlord and tenant over the condition of the rental property. The tenant believes that the landlord has not been maintaining the property, while the landlord believes that the tenant has caused damage to the property. After listening to both parties, what is your next step?

4. Question : You are mediating a dispute between two co-workers who cannot get along. One co-worker is very outgoing and tends to talk a lot, while the other is more introverted and prefers not to talk about her feelings. How do you deal with this difference in communication styles?

5. Question : You are mediating a dispute between a husband and wife over financial issues. The husband wants to keep all of the money in joint accounts, while the wife wants to open separate accounts. How do you deal with this disagreement?

6. Question : You are facilitating a discussion between two employees who have been arguing over a work issue. One employee is very emotional and is having difficulty staying calm, while the other is remaining relatively calm but is becoming increasingly frustrated with the situation. How do you deal with these differences?

7. Question : You are leading a discussion between two employees who have been arguing over a work issue. One employee is very emotional and is having difficulty staying calm, while the other is remaining relatively calm but is becoming increasingly frustrated with the situation. How do you deal with these differences?

8. Question : You are acting as a facilitator in a discussion between two employees who have been arguing over a work issue. One employee is very emotional and is having difficulty staying calm, while the other is remaining relatively calm but is becoming increasingly frustrated with the situation. How do you deal with these differences?

9. Question : You are acting as a coach in a discussion between two employees who have been arguing over a work issue. One employee is very emotional and is having difficulty staying calm, while the other is remaining relatively calm but is becoming increasingly frustrated with the situation. How do you deal with these differences?

CRJS 6742 Week 10 MCQ’s (20 Multiple Choice Questions)

1. Which of the following is NOT an element in the definition of conflict?
2. The concept of conflict as _____________ has been found to be useful in understanding many aspects of human behavior.
3. Social conflict theory posits that:
4. According to the text, what is an important difference between instrumental and expressive violence?
5. All of the following are considered to be methods for managing or resolving conflict EXCEPT:
6. According to the text, ___________ refers to “the ways in which different individuals and groups interact with each other.”
7. The term ___________ is used to describe a situation in which each party tries to outdo the other in order to gain an advantage.
8. The idea that all parties involved in a conflict can find some satisfaction is known as:
9. A(n) ___________ is a situation in which one party perceives that he or she is being treated unfairly or unfairly harmed by another party.
10. A ___________ is a long-term relationship between two people who interact with each other on a regular basis and who have established patterns of communication and interaction.
11. According to the text, which of the following is NOT an important consideration when trying to resolve a conflict?
12. In order for mediation to be successful, it is important that:
13. An example of an interpersonal conflict would be:
14. An example of an intrapersonal conflict would be:
15. All of the following are types of negotiation EXCEPT:
16. The process by which two or more parties attempt to reach an agreement about their conflicting interests is known as:
17. Which of the following statements about mediation is FALSE?
18. Arbitration is similar to mediation in that:
19. The role of an arbitrator is to:
20. Which of the following statements about arbitration is FALSE?

CRJS 6742 Week 11 Description

CRJS 6742 Course is designed to provide an overview of the various types of conflict, how they develop, and how they can be resolved. We will explore the role of conflict in society and its impact on individuals, groups, and organizations. The CRJS 6742 Course will also examine the methods and strategies used to resolve conflict and promote peace.

CRJS 6742 Week 11 Outline

Week 11 Outline for CRJS 6742 – Conflict, Conflict Resolution, and Peace (5 credits) (CRJS 6742)

• Introduction to Conflict Resolution

o Defining conflict and its resolution

o Theories of conflict and conflict resolution

• Approaches to Conflict Resolution

o Facilitation/mediation

o Arbitration/negotiation/collaboration

• Conflict in Contexts: Family, Schools, Workplaces, Communities, and Nations

o Applying conflict resolution approaches in different contexts

CRJS 6742 Week 11 Objectives

What is “conflict”?

How do different types of conflict affect the way we interact with others?

What are some common methods of conflict resolution?

What are the benefits and drawbacks of each method?

What are some factors that contribute to successful conflict resolution?

How can we create more peaceful societies?

CRJS 6742 Week 11 Pre-requisites

Week 11 Pre-requisites: Conflict, Conflict Resolution, and Peace (5 credits)

1. Introduction to Conflict, Conflict Resolution, and Peace

2. Theories of Conflict and Conflict Resolution

3. The Nature of Violence

4. Approaches to Peacebuilding

5. Reconciliation

CRJS 6742 Week 11 Duration

The class meets twice a week for 3 hours (6 hours total).

CRJS 6742 Week 11 Learning Outcomes

CRJS 6742 – Conflict, Conflict Resolution, and Peace (5 credits) (CRJS 6742) CRJS 6742 Course Learning Outcomes for Week 11: 1. Understand conflict resolution methods in the context of criminal justice and social conflict. 2. Analyze various conflict resolution models and apply them to case studies. 3. Understand how to mediate and facilitate conflict resolution between individuals and groups. 4. Understand the role of the criminal justice system in resolving social conflict. 5. Develop skills in identifying potential sources of social conflict and designing strategies for its prevention and resolution.

CRJS 6742 Week 11 Assessment & Grading

CRJS 6742 Week 11 Suggested Resources/Books

Required Textbook:

This book will give you a thorough understanding of the topic. The author, who was one of the most prominent voices in the field for nearly 40 years, is widely recognized as an excellent writer and thinker. His work is engaging and accessible, with a strong emphasis on applying theory to real-world situations.

Sarason, S. B., & Gurvis, S. (Eds.). (2008). Conflict resolution: Theory, research, and practice. New York: Routledge.

CRJS 6742 Week 11 Assignment (20 Questions)

1. In your own words, define the concept of conflict resolution. Give an example of how conflict resolution might be used in your personal or professional life.

2. Explain the difference between a constructive and a destructive conflict resolution style. Which do you think is more effective? Why?

3. Describe the Thomas-Kilmann Conflict Mode Instrument and how it can be used to resolve conflicts.

4. Discuss the role of power in conflict resolution. How can power be used effectively to resolve conflicts?

5. Explain the concept of mediation and describe how it can be used to resolve conflicts.

6. Describe the role of communication in conflict resolution. What are some effective communication strategies that can be used to resolve conflicts?

7. Discuss the concept of negotiation and describe how it can be used to resolve conflicts.

8. Explain the difference between interest-based and positional negotiation, and discuss when each might be most appropriate to use.

9. Discuss the concept of collaborative problem solving and describe how it can be used to resolve conflicts.

10. Describe the role of emotions in conflict resolution. How can emotions be effectively managed to resolve conflicts?

CRJS 6742 Week 11 Assignment Question (20 Questions)

Directions: Complete the following exam, which will assess your knowledge of topics covered during the CRJS 6742 Course. Your completed exam should be submitted to your instructor via your online learning platform. Note that this exam is open book/open notes; however, you may not consult with any other person during the exam. Any evidence of cheating or plagiarism will result in a failing grade for this exam and possible disciplinary action from the University.

1. Explain how victimization contributes to interpersonal conflict.

2. How does self-serving bias contribute to interpersonal conflict?

3. How can we reduce the impact of self-serving bias in our relationships?

4. What is the difference between constructive and destructive conflict?

5. What are some ways to handle destructive conflict constructively?

6. What is accommodation, and how does it contribute to interpersonal conflict?

7. What is avoidance, and how does it contribute to interpersonal conflict?

8. What is competition, and how does it contribute to interpersonal conflict?

9. What is collaboration, and how does it contribute to interpersonal conflict?

10. Explain how communication style contributes to interpersonal conflict.

CRJS 6742 Week 11 Discussion 1 (20 Questions)

Conflict, Conflict Resolution, and Peace (5 credits)

CRJS 6742 Course Description: CRJS 6742 Course focuses on conflict resolution strategies in international and intrastate settings. Students will develop a better understanding of the origins of conflict, escalation dynamics, and methods for managing and resolving disputes. In addition to identifying potential causes of violent conflict, students will learn about various peacekeeping operations and how different actors within the international system influence the process of conflict management. Students will also have an opportunity to explore how gender, religion, ethnicity, nationalism, and other social identities impact efforts to resolve conflicts.

CRJS 6742 Week 11 DQ 1 (20 Questions)

– Liberty University

Identify three main types of conflict resolution and provide a specific example of each. 1. Compromise: Each person gets part of what they want, but both people have to give something up. For example, you may compromise on where to go to lunch by letting your friend pick the restaurant today and you pick it tomorrow. 2. Collaboration: Both people work together to find a solution that meets both of their needs. For example, you may collaborate with your roommate to decide which furniture to buy for the living room. 3. Competition: Each person tries to get what they want without considering what the other person wants. For example, you may compete with your friends to see who can get the most likes on their social media posts.

CRJS 6742 Week 11 Discussion 2 (20 Questions)

CRJS 6742 Week 11 Discussion 1 (20 Questions) for CRJS 6742 – Conflict, Conflict Resolution, and Peace (5 credits) (CRJS 6742)

This preview shows pages 1–2. Sign up to view the full content. View Full Document

CRJS 6742 CRJS 6742 Week 11 Discussion 2 (20 Questions) – Conflict, Conflict Resolution, and Peace CRJS 6742 Course Information & Links: http://dl.dropboxusercontent.com/u/15864005/Online_Classes_Spring2013/CRJS6742_CRJS 6742 CourseInformationLinks_Spring2013.pdf Questions: http://dl.dropboxusercontent.com/u/15864005/Online_Classes_Spring2013/CRJS6742_CRJS 6742 CourseWeek11DiscussionQuestions-5credits-ConflictResolutionPeace(Spring2013).pdf CRJS 6742 Week 11 Discussion 2 (20 Questions) for CRJS 6742 – Conflict, Conflict Resolution, and Peace This is the end of the preview. Sign up to access the rest of the document.

Unformatted text preview: . . . . . . . . . . . . . . . . 17 Page 1 (of 2 ) © 2012 by Daniel Koehler and Stephen Blaker Page 2 of 2 This preview has intentionally blurred sections. Sign up to view the full version. View Full Document…

View Full Document

CRJS 6742 Week 11 DQ 2 (20 Questions)

1. What is the importance of conflict resolution?

2. What are the benefits of conflict resolution?

3. What are the different types of conflict resolution?

4. What are the steps involved in conflict resolution?

5. How can conflict resolution be used to prevent and resolve conflicts?

6. What are some common obstacles to effective conflict resolution?

7. How can conflicts be effectively managed and resolved?

8. What are some key strategies for preventing and resolving conflicts?

9. What are some common mistakes made in conflict resolution?

10. How can mediation be used to resolve conflicts?

CRJS 6742 Week 11 Quiz (20 Questions)

1) peacemaking circles, as developed by Mark and Alison Kroeger, are based on which of the following? a) Restorative justice b) Court-mandated mediation c) Process consultation d) Problem solving e) All of the above 2) Which of the following is a disadvantage to using mediation as a means of conflict resolution? a) The mediator can take sides b) Mediation is not effective when parties are not ready or willing to negotiate c) It can be difficult to keep the process confidential d) It is often used as an alternative to litigation e) All of the above 3) When deciding whether or not to mediate, which of the following should be considered? a) The type of conflict b) The parties involved c) The goals of the parties d) All of the above 4) When using mediation to resolve conflict, it is important to remember that ________. a) The mediator should be impartial b) The mediator should not take sides c) The mediator should try to find a solution that is acceptable to both parties d) All of the above 5) Which of the following is true about peacemaking circles? a) They are based on traditional First Nations methods of conflict resolution b) They are used primarily in criminal cases c) They are voluntary d) All of the above 6) In order for mediation to be successful, ________. a) The parties must want to mediate b) The parties must be willing to compromise c) Both parties must be represented by an attorney d) All of the above 7

CRJS 6742 Week 11 MCQ’s (20 Multiple Choice Questions)

(CRJS6742)

Quiz

Question 1 1 / 1 point

Which of the following statements is TRUE about the meaning of conflict? Conflict is always negative and should be avoided at all costs.

Conflict can occur among humans, animals, and objects.

Conflict occurs when someone or something tries to take what belongs to another.

CRJS 6742 Week 12 Description

CRJS 6742 Course explores the nature of conflict, conflict resolution, and peace. Through readings, discussions, and simulations, students will develop an understanding of the sources of conflict, methods for managing and resolving conflict, and the role of peace in society.

CRJS 6742 Week 12 Outline

This is the outline for Conflict, Conflict Resolution, and Peace (CRJS 6742) for CRJS 6742 Week 12.

The topics that will be covered are:

• Overview of conflict resolution theory and practice

• Models of conflict resolution

• Theories of conflict resolution

• Techniques for conflict resolution

• Conflict resolution in practice

CRJS 6742 Week 12 Objectives

1. Explore the causes of conflict and violence.

2. Examine the role of conflict in social change.

3. Understand the process of conflict resolution.

4. Analyze the impact of conflict on individuals and communities.

5. Evaluate different approaches to peacebuilding.

CRJS 6742 Week 12 Pre-requisites

CRJS 6742 Conflict, Conflict Resolution, and Peace (5 credits) CRJS 6742 Course explores conflict resolution theory, practice, and research. Topics include: conflict theory; communication and negotiation; mediation; conflict transformation; international conflict resolution; and peacebuilding. Students will develop practical skills in managing interpersonal conflict and community disputes, as well as in facilitating mediation sessions. NOTE: CRJS 6742 Course is not eligible for Credit/D/Fail grading. Grading Basis: Graded DETAILS SECTION TITLE & LOCATION: CRJS 6742 A01, TUE/THUR 2-3:20pm, WOOD 1 CHEM B160 CRJS 6742 A02, TUE/THUR 3:30-4:50pm, WOOD 1 CHEM B160 CRJS 6742 A03, TUE/THUR 5-6:20pm, WOOD 1 CHEM B160 EXCLUSIONS: CRJS 4120

CRJS 6742 Week 12 Duration

In CRJS 6742 Course, students will study the various forms and causes of conflict within societies. They will learn about the role of conflict in social change and the different ways in which it can be resolved. The CRJS 6742 Course will also cover the concept of peace and its importance in promoting social cohesion and stability.

CRJS 6742 Week 12 Learning Outcomes

1. Understand the importance of conflict in our lives.
2. Understand how to manage and resolve conflict.
3. Understand the concept of peace and how to achieve it.

CRJS 6742 Week 12 Assessment & Grading

Assessment and Grading for CRJS 6742 – Conflict, Conflict Resolution, and Peace (5 credits)

Assessment and Grading for CRJS 6742 – Conflict, Conflict Resolution, and Peace (5 credits) is based on the following:

– Class Participation (including but not limited to in-class discussion, small group work, presentations) (30%)
– Research Paper (70%)

CRJS 6742 Week 12 Suggested Resources/Books

CRJS 6742 Week 13 Suggested Resources/Books for CRJS 6742 – Conflict, Conflict Resolution, and Peace (5 credits) (CRJS 6742)

CRJS 6742 Week 14 Suggested Resources/Books for CRJS 6742 – Conflict, Conflict Resolution, and Peace (5 credits) (CRJS 6742)

CRJS 6742 Week 15 Suggested Resources/Books for CRJS 6742 – Conflict, Conflict Resolution, and Peace (5 credits) (CRJS 6742)

CRJS 6742 Week 12 Assignment (20 Questions)

How to access the assignment?

1. Go to https://blackboard.uttyler.edu/
2. Enter your Username and Password (same as Eagle email)
3. Click Login
4. In the Search Bar, type CRJS 6742 – Conflict, Conflict Resolution, and Peace (5 credits) (CRJS 6742) and click Go
5. The class should appear in the results; click on it to enter the Classroom
6. On the left-hand side of the screen, click on CRJS 6742 Course Content and find Assignment #12 – Quiz – Week 12 Assignment (20 Questions) for CRJS 6742 – Conflict, Conflict Resolution, and Peace (5 credits) (CRJS 6742). Click on it to open it up and take the quiz.
7. Once you have completed all 20 questions, click Submit at the bottom of the page

CRJS 6742 Week 12 Assignment Question (20 Questions)

CRJS 6742 CRJS 6742 Course Description:

CRJS 6742 Course focuses on the examination of conflict in its various forms. It emphasizes conflict resolution techniques and processes, as well as the role of conflict in promoting peace. It also examines the relationship between violence and conflict, as well as the ways in which different types of conflict may be managed.

CRJS 6742 Week 12 Discussion 1 (20 Questions)

Complete the following: Read Case Study 12.1 in your textbook (attached) and respond to the following questions. Please review the Discussion Board Forum Rubric for guidance on how your discussion will be graded. The length of your initial post should be a minimum of 250 words and you are required to utilize at least one scholarly source other than your textbook. You may want to consider using the Argosy University online library resources; however, this is not required. Write your initial post and be sure to respond to at least two other students’ posts by Day 7 in order to earn full participation credit for this discussion board forum. 1) What are some of the obstacles that need to be overcome for the conflict resolution process? 2) Identify some of the key conflicts between Alana and Mark that need to be addressed? 3) How might Alana and Mark work together during their conflict resolution process? 4) Are there any issues that may arise during their conflict resolution process? If so, what are they? 5) What do you think will happen if Alana and Mark don’t successfully resolve their conflict?

CRJS 6742 Week 12 DQ 1 (20 Questions)

CRJS 6742 Course is an overview of conflict and its resolution, with a focus on peace. The CRJS 6742 Course will examine various forms of conflict (e.g., interpersonal, intergroup, international, and intractable), their causes, and the methods used to resolve them. Theories of conflict and aggression will be explored, as well as the role of communication in conflict and peacemaking. The CRJS 6742 Course will also cover the nature of peace and the ways in which it can be promoted.

CRJS 6742 Week 12 Discussion 2 (20 Questions)

1. Why is it important to study conflict?

2. What are some of the different types of conflict?

3. How can we manage and resolve conflict effectively?

4. What are some of the strategies for managing and resolving conflict?

5. What are some of the benefits of managing and resolving conflict effectively?

CRJS 6742 Week 12 DQ 2 (20 Questions)

1. What are some of the important theories and strategies for conflict management?

2. How can we understand conflict management in terms of human needs and interests?

3. What is the role of communication in conflict management?

4. How can we use conflict management to build relationships and achieve our goals?

5. What are some of the obstacles to effective conflict management?

CRJS 6742 Week 12 Quiz (20 Questions)

1) When a party has reason to believe that it can achieve its goals by negotiation, but finds itself unable to do so, the party may resort to:
2) In the conflict resolution field, positional bargaining is also known as:
3) The problem-solving approach to negotiation focuses on:
4) A(n) ________ is a process in which one party uses force or the threat of force to compel another to act against his or her will.
5) A fundamental characteristic of an integrative negotiation is that:
6) During an integrative negotiation, parties should:
7) The problem-solving approach is more likely than positional bargaining to result in:
8) When parties share a common interest in resolving a conflict, they are said to have a(n):
9) Most conflicts involve some degree of __________, which refers to the emotional arousal that accompanies conflict.
10) According to the text, __________ is/are the “people’s wars” of our time.
11) Which of the following is NOT one of the four major types of international conflict?
12) The term “asymmetrical warfare” is used to describe conflicts in which:
13) Which of the following factors has NOT been identified as contributing to an increased risk of interstate war?
14) According to the text, which of the following is NOT one of the three major approaches to managing international conflict?
15) Which of the following statements about mediation is FALSE?
16) Arbitration is similar to mediation in that:
17) Which of the following statements about facilitation is FALSE?
18) A ________ is a formal process for making decisions in which an impartial third party hears each side’s arguments and then renders a binding decision.
19) The term ” adjudication” refers to:
20) The most important difference between arbitration and adjudication is that:

CRJS 6742 Week 12 MCQ’s (20 Multiple Choice Questions)

1. What is the definition of conflict?

A. A struggle for control of resources in which the interests of the participants are mutually exclusive and incompatible
B. A dispute between two or more parties that involves some degree of hostility and is resolved through the use of force or violence
C. A situation in which two or more people disagree about something
D. All of the above

D. All of the above

CRJS 6742 Week 13 Description

CRJS 6742 Course is designed to provide students with an understanding of the dynamics of conflict and conflict resolution. The CRJS 6742 Course will cover such topics as interpersonal conflict, intractable conflict, the role of emotion in conflict, third party interventions, and the relationship between conflict and violence.

CRJS 6742 Week 13 Outline

CRJS 6742 – Conflict, Conflict Resolution, and Peace (5 credits)

Instructor: TBD

Office: TBD

Email: TBD@unm.edu

Phone: 505-277-XXXX

Lecture Time: Tuesday and Thursday, 1:00pm – 2:15pm in sociology building room number TBD.
Lecture Location: Sociology Building Room Number TBD
===============================================================

I. Introduction (Tuesday, January 17)

II. Conflict Theory (Thursday, January 19)

III. Social Control Theories (Tuesday, January 24)

IV. Power and Conflict (Thursday, January 26)

V. Managing Conflict (Tuesday, January 31)

VI. Violence and Aggression (Thursday, February 2)

VII. Mediation and Arbitration (Tuesday, February 7)

VIII. Restorative Justice (Thursday, February 9)

IX. CRJS 6742 Course Conclusion/Wrap-Up (Tuesday, February 14)

CRJS 6742 Week 13 Objectives

1. Outline the major approaches to conflict management and conflict resolution.

2. Explain how various methods of conflict management and conflict resolution can be applied to different types of conflicts.

3. Analyze the role of emotions in conflicts and how they can impact the management and resolution of those conflicts.

4. Evaluate different approaches to managing and resolving conflicts, and identify when it may be appropriate to use each approach.

5. Discuss the role of power in conflicts and how it can impact the management and resolution of those conflicts.

CRJS 6742 Week 13 Pre-requisites

CRJS 6742 – Conflict, Conflict Resolution, and Peace (5 credits) CRJS 6742 Course is an overview of the field of conflict resolution and peace studies, including the analysis of past and present conflicts. Topics include: the origins and causes of conflict; approaches to conflict management and resolution; violence and nonviolence; international mediation; and peacebuilding.

CRJS 6742 Week 13 Duration

The duration of CRJS 6742 Course is 5 weeks.

CRJS 6742 Week 13 Learning Outcomes

• Identify different types of conflict and how they impact individuals, organizations, and society as a whole.

• Understand various approaches to conflict resolution and their strengths and weaknesses.

• Develop skills in identifying potential areas of conflict and resolving them effectively.

• Understand the role of peace in conflict resolution and its importance in creating lasting solutions.

• Apply concepts learned in the CRJS 6742 Course to real-world situations.

CRJS 6742 Week 13 Assessment & Grading

CRJS 6742 Course will introduce students to the concepts of conflict and conflict resolution. Students will examine the role that conflict plays in society and explore various methods of resolving conflict. The CRJS 6742 Course will also examine the causes of violence and the ways in which peace can be promoted.

CRJS 6742 Week 13 Suggested Resources/Books

Additional Resources:

• To view the syllabus for CRJS 6742 Course, please visit http://www.park.edu/syllabi (You will need to search by department – CRJS and CRJS 6742 Course title – CRJS 6742).
* Conflict Resolution: An Integrated Approach to Managing Workplace Disputes – Sam Berman (Author), William M. Kleiner (Author)
* Conflict and Change: Foreign Policy in a World Transformed – John W. McDonald, Joseph J. Kruzel (Contributor)
* A Concise Introduction to Logic – Patrick Hurley
* Essentials of Psychology: Concepts and Applications – Jeffrey S. Nevid, Spencer A. Rathus, Beverly Greene
* Discovering Sociology: Using MicroCase ExplorIt – William Little, Stephen J. McNall

CRJS 6742 Week 13 Assignment (20 Questions)

1. Why is it important to understand conflict and its causes?

2. What are some of the different types of conflict?

3. What are some of the different approaches to conflict resolution?

4. What are some of the benefits of resolving conflict?

5. What are some of the challenges involved in resolving conflict?

6. How can we prevent or reduce conflict?

7. How can we effectively manage conflict once it has arisen?

8. What role does communication play in conflict resolution?

9. How can we improve our communication skills to better resolve conflict?

10. What role do emotions play in conflict?

11. How can we manage our emotions during times of conflict?

CRJS 6742 Week 13 Assignment Question (20 Questions)

Please submit your answers to this exam by email to sswift@icn.edu no later than 10:00 PM CST Sunday December 9, 2018. This exam is worth 100 points (100% of the grade). Good Luck! 1. Explain the difference between aggression and conflict. Aggression is defined as an unprovoked attack with the intent to do harm whereas conflict is defined as a perceived incompatibility of actions or goals. 2. What are some of the key differences between prisons in Mexico and prisons in the United States? In Mexico, prisoners are not segregated by offense and are expected to work while incarcerated. Prisons in the United States are segregated by offense and prisoners are not required to work while incarcerated. 3. Explain how gangs develop and how they maintain their power within prisons. Gangs develop in prisons as a way for inmates to feel a sense of power and control. They maintain their power by using violence and intimidation against other inmates and prison staff. 4. Describe how the concept of “restorative justice” can be used to reduce recidivism among juvenile offenders. Restorative justice is a process whereby victims and offenders are brought together to discuss the impact of the crime and to develop a plan for restitution. This process can reduce recidivism by helping offenders to take responsibility for their actions and by providing them with a support system to avoid future criminal behavior. 5. What are some of the key differences between mediation and arbitration? Mediation is a process whereby two parties attempt to reach an agreement with the assistance of a neutral third party. Arbitration is a process whereby two parties submit their dispute to a neutral third party who renders a binding decision. 6. Describe how the concept of “community policing” can be used to reduce crime and improve police-community relations. Community policing is a proactive approach to law enforcement that emphasizes building relationships with members of the community in order to prevent crime and solve problems. 7. What are some of the key differences between community supervision and incarceration? Community supervision is a form of punishment that allows offenders to remain in the community under the supervision of probation or parole officers. Incarceration is a form of punishment that requires offenders to serve time in prison or jail. 8

CRJS 6742 Week 13 Discussion 1 (20 Questions)

1) What are the five “C”s of effective conflict resolution? Do you agree with this model? Why or why not?

2) How might an understanding of the conflict escalation process help individuals resolve conflict more effectively?

3) Why is it important to understand the different types of conflict? Give an example of how this knowledge might be used in resolving a specific conflict.

4) Explain the difference between distributive and integrative negotiation. Which do you feel is more effective in resolving conflict and why?

5) Discuss the role of power in negotiation. How can an understanding of power dynamics help individuals resolve conflict more effectively?

6) Explain the importance of communication in conflict resolution. What are some specific strategies that can be used to improve communication and resolve conflict?

7) What are some common obstacles to effective conflict resolution? How can these obstacles be overcome?

8) What are some common mistakes that people make when trying to resolve conflict? What are some tips for avoiding these mistakes?

9) Discuss the role of emotions in conflict resolution. How can an understanding of emotions help individuals resolve conflict more effectively?

10) What are some common myths about conflict resolution? What is the reality behind these myths?

CRJS 6742 Week 13 DQ 1 (20 Questions)

1. Which of the following is NOT an example of a formal conflict resolution process?

A. facilitated negotiation
B. collaborative problem solving
C. ombudsman
D. litigation

2. A facilitator is someone who:

A. is impartial and objective and facilitates communication between parties to help them resolve their differences.
B. is a lawyer who represents one of the parties in a dispute and helps them to negotiate a settlement.
C. is a judge who hears evidence and decides on a CRJS 6742 Course of action in a dispute.
D. is a mediator who helps parties to reach a mutually agreeable solution to their differences.

3. A ___________ is someone who acts as an intermediary between two parties in order to help them reach an agreement or understanding.

A. lawyer
B. judge
C. mediator
D. arbitrator
4. In mediation, the ____________ decides what the outcome of the mediation will be, whereas in arbitration, the ____________ makes a binding decision about the outcome of the dispute.

A. mediator; arbitrator
B. arbitrator; mediator
C. court; arbitrator
D. court; mediator
5. The first step in mediation is usually:
A. for the mediator to meet with each party separately to assess the situation and see if there are any common ground between them.
B. for the mediator to hold an opening session with both parties present, during which each party has an opportunity to state their case clearly and without interruption from the other party or the mediator.
C. for the parties to come to an agreement about how they will proceed with mediation and what the rules will be for the process.
D. for the mediator to gather information about each party’s position on the issue in dispute and what their interests are in relation to it.

CRJS 6742 Week 13 Discussion 2 (20 Questions)

Using the textbook, lecture materials, and external research, answer the following questions:

1. Explain how conflict affects relationships. (Ch. 1)

2. Define conflict resolution and identify its goals. (Ch. 1)

3. Discuss the six basic steps of problem-solving/conflict resolution. (Ch. 2)

4. Identify and discuss the three main styles of handling conflict. (Ch. 3)

5. Discuss the advantages and disadvantages of each conflict resolution style. (Ch. 3)

6. Identify your preferred style of handling conflict and provide an example of a situation in which it would be effective. (Ch. 3)

7. Discuss the concept of emotional intelligence and its relevance to conflict resolution. (Chs. 4 & 5)

8. Define mediation and describe its advantages as a means of conflict resolution. (Chs. 6 & 7)

9. Describe the role of a mediator in facilitating a successful mediation session.(Chs

CRJS 6742 Week 13 DQ 2 (20 Questions)

What are some strategies for managing conflict in relationships?

1. Communicate openly and honestly with each other.

2. Respect each other’s opinions and perspectives.

3. Listen to each other carefully and try to understand each other’s point of view.

4. Avoid making assumptions about what the other person is thinking or feeling.

5. Avoid speaking in absolutes (“always” or “never”).

6. Be willing to compromise and find creative solutions that satisfy both parties.

7. Take a break from the situation if things start to get heated. Come back to it later when you’ve both had a chance to calm down.

8. Seek professional help if you’re having difficulty resolving your differences on your own.

CRJS 6742 Week 13 Quiz (20 Questions)

1) When a party believes that the other has acted unfairly and decides to use force to remedy the situation, this is referred to as ________.
2) The concept of jus ad bellum refers to ________.
3) A state of war exists when ________.
4) The legal authority of a state to engage in war is called ________.
5) The right of a state to defend its territorial integrity and political independence is referred to as ________.
6) A state of war exists when one state has declared war on another, or when ________.
7) The right of a state to use force in self-defense is referred to as ________.
8) The right of a state to protect its citizens abroad is known as ________.
9) The right of a state to intervene in the affairs of another state in order to protect its citizens is known as ________.
10) The doctrine that holds that states have a responsibility to protect their citizens from genocide, ethnic cleansing, and other mass atrocities is known as the ________.
11) The legal authority of the UN Security Council to authorize the use of force is derived from ________.
12) The concept of jus in bello refers to ________.
13) The rules governing the conduct of hostilities are known as the ________.
14) The principle that prohibits targeting civilians during wartime is known as the ________.
15) An act committed during wartime that violates the laws of war but does not rise to the level of a war crime is known as a(n) ________.
16) An act committed during wartime that violates the laws of war and is punishable under international law is known as a(n) ________.
17) Crimes against humanity are defined as widespread or systematic attacks directed against any civilian population with knowledge of the attack, with the intention of destroying, in whole or in part, that population. Which statement about crimes against humanity is FALSE?
18) Genocide is defined as any act committed with intent to destroy, in whole or in part, a national, ethnic, racial, or religious group. Which statement about genocide is FALSE?
19) Apartheid is defined as an institutionalized system of racial segregation and discrimination for the purpose of maintaining power over a subjugated population. Which statement about apartheid is FALSE?
20) What was the first international treaty to comprehensively codify the laws of war?

CRJS 6742 Week 13 MCQ’s (20 Multiple Choice Questions)

1) Conflict is:
a. The process of achieving peace in the world.
b. The presence of tension between people or groups.
c. A constructive process that can lead to positive outcomes.
d. A destructive process that always leads to negative outcomes.
e. None of the above

B) The presence of tension between people or groups.

The CRJS 6742 Course is an overview of the theoretical, practical and interpersonal aspects of conflict, conflict resolution and peace. The first section of the CRJS 6742 Course focuses on theoretical models of conflict, with an emphasis on how to understand, diagnose and manage conflict in a variety of settings. In the second section, students learn about the skills necessary for effective conflict resolution, with a focus on how to mediate disputes and negotiate agreements. The final section of the CRJS 6742 Course explores the concept of peace and looks at how it can be promoted through education, conflict resolution and other means.